SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003817 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003817
Domain Number 1 Region: 5-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-36
Family SPRY domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003817   Gene: ENSTNIG00000000236   Transcript: ENSTNIT00000002793
Sequence length 187
Comment pep:known_by_projection chromosome:TETRAODON8:3:15177100:15177970:-1 gene:ENSTNIG00000000236 transcript:ENSTNIT00000002793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPTTRADLMKYWVPISLDDRTAQKLLWISEGGAKVARTSDAICPYPNRPERYEHSPQVLC
KESLLGRRAYWEVDYQGWVVVGLVCQSAPRKGHQGASGLGENRASWGAGWSGSCYQVWHD
GENEDVPLPQAATLGVYLDQPAGLLKFLLVEGDAEKEVRLIHKFRVDIRENVFPGFWVGA
NSFCLIR
Download sequence
Identical sequences H3C6E7
99883.ENSTNIP00000003817 ENSTNIP00000003817 ENSTNIP00000003817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]