SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003828 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003828
Domain Number 1 Region: 283-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-47
Family SPRY domain 0.00017
Further Details:      
 
Domain Number 2 Region: 8-77
Classification Level Classification E-value
Superfamily RING/U-box 6.48e-19
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 85-135
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000305
Family B-box zinc-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003828
Domain Number - Region: 135-234
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0235
Family Fibrinogen coiled-coil and central regions 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003828   Gene: ENSTNIG00000008203   Transcript: ENSTNIT00000002864
Sequence length 457
Comment pep:known_by_projection chromosome:TETRAODON8:8:961554:964714:-1 gene:ENSTNIG00000008203 transcript:ENSTNIT00000002864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQDVSEELFHQEMTCSVCRDIFKDPWVLPCSHSFCQECLQGSVNPRGRRCPLCRESFVE
GRAVPNRVLSDICRAYKTYPLPGIQKPDGEAVCKLHMKPLELYCEKDEQPVCVECVTMHN
THTLWPLKDAVPLCKLSGALEQKIQIFERKVTSYQTLTQNLDNTVDYIKNQASEAEKQIQ
VEFKKLRDALLTEERLRLSELAQEEEQKIAAVQKLTKNVNQDISDLKKLIVSVKKEIGNE
DLRLLQDLKIWRRDRLRRHGKFDIQFCACDTVRSVITRVFKMSLFADPVVFDPNTASPWL
SLDADLTAVKESHEPLITPDNPERFDPCGFVLGAEGYTSGKHRWDVMVRDCPSWVVGVCK
EAVARKKKFTLSPSRGVWCIGLSKGVCTAFTNERMALQVQQRLERIRIKLDMDKGEVSFW
DGESATHLVTLQHNFNVKIFPFFGPGVHSTSMILVPG
Download sequence
Identical sequences H3C6F8
ENSTNIP00000003828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]