SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003830 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003830
Domain Number 1 Region: 861-998
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000275
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 758-904
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000957
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 566-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000571
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 4 Region: 645-762
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000135
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 399-506,565-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000534
Family Growth factor receptor domain 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003830
Domain Number - Region: 985-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000686
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003830   Gene: ENSTNIG00000017936   Transcript: ENSTNIT00000003632
Sequence length 1146
Comment pep:known_by_projection chromosome:TETRAODON8:9:6898588:6912659:-1 gene:ENSTNIG00000017936 transcript:ENSTNIT00000003632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDCTGVDCPPVDNCLQTTLEVGACCPTCTQRGCTCEGYQYYDCIHAGFQKGKVPEGESYF
VDFGSTECSCPQGGGKISCHFIPCPELPSNCIDILQPEDGCLQCERIGCTHGNKKYEAGH
SFQMDQCHVCHCPNEGGKLMCSLIPGCDLRGSNKPVRVGVTTTEDNSRFREINSRPDTSQ
VSPMEPHSKLALGNTLPLYKQDPPGFGTVKYDDTLAGPTSSSVQKLAQPLESTTVPAAFP
EPNSTSSSSHDEQRHELREPQETREAAVTQDIGPTTTEAQSKPTTVLTTTQEVTTEDLRP
QQEAGKSPLEHHLQSPGVLQVPLKDVFHTAHPREQKPSQGPPSRSHASFHSEVEDEESQH
LFLIYGLRTENRLDPVSVHGLIGPPLNGVSAKELVQTCCETGEKWASSNGHCNDMEPPTK
DMHSICWTAQRQCCVGSLGETQCLAGINAARGGEACPKKVSNNCETDSYKECCDCCFLGL
QLRSEGRRCEPHRYLGFHCRHVFLTCCEGEEGSHEERYSAVRERPTFTSSPPLQKISDSP
YPREAFFIGEEQDGGNAVEDPIEGEDTNECLIYEGNICHHRCINTPGSFRCECFPGYVLQ
EDAFTCVPGNEAVEEDNRLKETEGPAVKPTSPLPPPTEPPAPADPCQGNSPCQQQCTSVG
GRPHCSCFPGFSLMTDGVSCMDVNECLSGRVCKLNQLCVNTVGSYVCQRLIICPPGYQIS
NDICEDINECVQQSHNCGQDQECVNTEGSFRCNSKPRCPLGFNRESAGTDTDECGASSQT
CSPAFNCINTVGSFVCQRKLVCSRGYHSSPDGSKCVDVDECQSGAHRCGGGQLCHNLPGS
YRCECQTGYEYNSFRRMCVGTSDRCWRYSGRVCAQTCENTPGSYECSCTSGFRLSSDGKN
CESPDVNECLASPCSQECANIYGSYQCYCRQGYFLRQDGHTCDDIDECSQSIGHLCTYKC
VNVPGSYQCACPEYGYTMSANGRSCRDVDECTTGAHNCSVAETCYNIQGGYRCLSLSCPP
NYRKVSDTRCERINCPNYLECQNSPLRITYYYLSFQSNIVVPAQIFRIGPSPAYSGDNVI
ISITQGNEDSYFSTRKLNAYTGAVYLQRQVEGPRDFLINVEMKLWRQGTFTTFHARIYVF
ITGNSV
Download sequence
Identical sequences H3C6G0
ENSTNIP00000003830 99883.ENSTNIP00000003830 ENSTNIP00000021097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]