SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003837 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003837
Domain Number 1 Region: 151-224
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 92-158
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000243
Family Cadherin 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003837
Domain Number - Region: 282-320
Classification Level Classification E-value
Superfamily Cadherin-like 0.0117
Family Cadherin 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003837   Gene: ENSTNIG00000000810   Transcript: ENSTNIT00000001686
Sequence length 398
Comment pep:known_by_projection chromosome:TETRAODON8:8:7554511:7558295:-1 gene:ENSTNIG00000000810 transcript:ENSTNIT00000001686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALHNGSILSHLARSFCFHPGAVARHSIDLSSKTEMLSPVLLLLPLLFSAAGGKDLEEQ
KGPFRDIQLVVAEAAPVPYALYQFLVPNHIDSFRLSGEGKGEFEMSSDGWLYVQRPLDWS
REDHYVMMIEALAGDQVVDGPVYVTVSVLDINNNPPSFNQSVYTAWVRERTPAGVPFTHV
FAEDKDDPTTPNAALLYTLVSQIPSRSNVPFFQIDPETGAISTTEEGQQMLKAREGIRYS
RGEEQTIETLRTKFNSYCPVQNIPYEQNPFYTCVERAELRKRNVDPLSDPDYTLIVRAQD
LGGKSNTALSGNTRVQIVVLENLWVNPGPLVVMEHLAVVYPLVIAKGSIQQSGSRLHLNA
KRARAEVPLPDHGGRRDPADGGAGQRRQEHVHPCSEGN
Download sequence
Identical sequences H3C6G7
ENSTNIP00000003837 99883.ENSTNIP00000003837 ENSTNIP00000003837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]