SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003862 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003862
Domain Number 1 Region: 115-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000019
Family Cripto EGF-like domain-like 0.0054
Further Details:      
 
Domain Number 2 Region: 78-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000398
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003862   Gene: ENSTNIG00000001359   Transcript: ENSTNIT00000003438
Sequence length 193
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:33123934:33125926:-1 gene:ENSTNIG00000001359 transcript:ENSTNIT00000003438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTRRTGTVALLWVVCAAALPASDCDGEECSRARTKSQQQDYPWTSSPNCPLTKRRRSAI
HRDASAVLPYRYGLTEHAEQSRSCCKNGGTCILGSFCACPPFFTGRNCEYDQRVRSCGLI
SHGEWVQKGCSYCRCGYGILHCFANIFHKDCAFLSFPADDSEELRWLRSSASRVEVKSLL
AAAQLSFLLLLLL
Download sequence
Identical sequences H3C6J2
ENSTNIP00000003862 ENSTNIP00000003862 99883.ENSTNIP00000003862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]