SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003867 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003867
Domain Number 1 Region: 616-687
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.45e-17
Family SAM (sterile alpha motif) domain 0.00097
Further Details:      
 
Domain Number 2 Region: 536-635
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000171
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1105-1173
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000109
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003867   Gene: ENSTNIG00000012250   Transcript: ENSTNIT00000000636
Sequence length 1183
Comment pep:known_by_projection chromosome:TETRAODON8:14:2987112:3014498:-1 gene:ENSTNIG00000012250 transcript:ENSTNIT00000000636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDRGPAAPPDEPPADGAALPDSFSQLWSDVMGMLDGSLGNIDDLAQEYSDYYNTCFSD
VSDRMEELRRRRVSQELDMDKQDPSNPSLQLRTEMQESLGFSSEVSTPETDRKMPLHKSN
SEDGSNGKWDKKKNKSFWQNFRKSQNKPVGRQTSKGDDIGYVASEITMSDEERIQLMMMV
KEKMITIEEALARLKEYELSRQSSSTDTAEWTDGSPASLNQSSNCNSREQSDDEQSEDSV
KFRRLHKLVNSTRRVKKKLIKVEENKKHAPEDFLNVEALPTCEDSTALYTGVLKKPPLAQ
ETSLSSLTQDQLSLDGDTDSLTNSPSSSSLDTWSGHKLVKTFSKSSSTHGLIRPPRRAPV
ELDGCGLEDDGKLSRSTTDGEMRRALSSISHGRTCSFGGFDLTNRSLHVVNSGTEANTRE
QEPIYREVIKSPTTSRISLGKKVKSVKETMRKRMSKKYSSSFSEQSSPDGAPGSPQSPQP
DMDSLEKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSASNRESVKSEDGDDEEPPYR
GPFCGRARVHTDFTPSPYDTDSLKLKRGDVIDIISKPPMGTWMGLLNNKVGTFKFIYVDV
LSEEEEKPKRPVRRRRKGRPPKPTSVEELLERLNLKEHMPTFLFNGYEDLDTFKLLEEED
LDELNIRDPQHRAVLLTAVELLQEYDSSSDPERLSGSQEKLLSEGRGLVGDSPRDSGCYE
SNENLENGNDSFPPLPTTRADKCSDESKLLSQSRTQIPNYPTLPMTFSTEALQNNQKSQR
TKGSKSFLLKPSLKSFGLRGLRKAHRRLPIPVSRSCEDLDGPPQPTKNWKRSHSLGDLHW
EKKVEQRDLGGELKLGKEGPKPGQSSPTRMGKLQLPSAQNGALSPKGRGARPAVPSQLPL
VHTCRNQSSRPPELVSSPTPSPPESGSGERIIRTHPKKPPVPPPVPAKKSRERLANGLSP
VVRSPSPSAPALPAKNPSTPASPSAASPASSVGEDSGSAPATPPPWLSDLGGKVCVSRKA
SHSKMSLDLLTLVEQRLEAEGIDLTEEPYSDKHGRCGIPQPLVQRYSEDLEQPVKDVASS
MDQLRVRELRKQHRMAIPSGGLTEMCRRPQPSGNISSVSDWLTSIGLPMYASPLAAAGVH
TLSGVSSLTESGAREAGVRDERHLRRLVGEARLVGTEPAGLSS
Download sequence
Identical sequences H3C6J7
99883.ENSTNIP00000003867 ENSTNIP00000003867 ENSTNIP00000003867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]