SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003898 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003898
Domain Number 1 Region: 190-312
Classification Level Classification E-value
Superfamily E set domains 4.27e-17
Family Arrestin/Vps26-like 0.019
Further Details:      
 
Domain Number 2 Region: 18-176
Classification Level Classification E-value
Superfamily E set domains 1.05e-16
Family Arrestin/Vps26-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003898   Gene: ENSTNIG00000000172   Transcript: ENSTNIT00000001810
Sequence length 319
Comment pep:novel chromosome:TETRAODON8:12:2657610:2659650:-1 gene:ENSTNIG00000000172 transcript:ENSTNIT00000001810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQQTITNFNINYDVYNESRSFCSGDRVTGKISFELKKETKISAIRMEFRGTAHVHWSTS
GGKNRRRRNYSARLDYFHIKSSILEDSSGMPPPRQFAPELRFKSLKGKYSMFPPAAAVGG
LRLQAGTHVYPFTLQIPEGDFPSTFRGIHGTVTYNLTVTIDRPWHLSKSFVTELMFRSRM
NLNDPQLWCPLSGSNSTTLCCLWCASGPITLTATAEKKAFSPGETLKIVCEISNASSRTV
TPKMKLLQKQNFYTHNKVSRRLYSQTLASVNGHTISPHSSEVHTELLLTIPSSAPCSISN
CSILEVQYVVEVGNTDRWR
Download sequence
Identical sequences H3C6M7
99883.ENSTNIP00000003898 ENSTNIP00000003898 ENSTNIP00000003898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]