SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003909 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003909
Domain Number 1 Region: 13-84
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-16
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 118-298
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000000424
Family BAR domain 0.025
Further Details:      
 
Domain Number 3 Region: 348-415
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000435
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003909   Gene: ENSTNIG00000000375   Transcript: ENSTNIT00000000274
Sequence length 439
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:59472128:59474463:-1 gene:ENSTNIG00000000375 transcript:ENSTNIT00000000274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVLESEAALVCRPEVNATSLSFFLVMPVQRVARYPLLLQTLQKLTPEAHPASGLLRQAA
HASVALNCRINEYKRLREVADKYKNPEQLSIKEKINRLSTHSIAKKTARISLQLKHEAGI
RPKLVDEDFEALEGFFCALEQGVLQLLDNVQLFLLQRFLACRTEEFDLELEGEREAASVQ
EVGTALRQWLLPTLEDRTRTLVLGPLLVLRDLLRGPRNLIRKRLDKLLDYEQICEKASLS
YEEQAVASTYRPSIALLLQELPRFHSLALQVLWTVVGAFSCLHRDLAADMEQLLLSSAQQ
VWRWAESAVLDAARRLDTLCLSVQDSLKAPVAQPLSPSSRRRLKQLTDKHGSGRIYQLTG
TAVASRDLDLSLSRGELVAVLSEADTRGDGRRWLVDAGGRRGYAPSSKLTPYHQPAEAEA
SGASGLTQDLWQPAQEPVE
Download sequence
Identical sequences H3C6N8
ENSTNIP00000003909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]