SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003910 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003910
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.29e-22
Family Clostridium neurotoxins, the second last domain 0.036
Further Details:      
 
Domain Number 2 Region: 359-498,531-551
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000000141
Family Astacin 0.082
Further Details:      
 
Domain Number 3 Region: 1185-1247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000931
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 4 Region: 1243-1314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000104
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 5 Region: 1308-1365
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000292
Family Complement control module/SCR domain 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003910
Domain Number - Region: 1116-1185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0005
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number - Region: 316-376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00628
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number - Region: 779-848
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0638
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003910   Gene: ENSTNIG00000017617   Transcript: ENSTNIT00000003021
Sequence length 1512
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:20244190:20279970:1 gene:ENSTNIG00000017617 transcript:ENSTNIT00000003021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYFGGGREQLKLDPAAGLELPRDKFSLELWLKPEGGQSNPAVVAGVFDHCSHSLSDKGWS
VGIRTFGPSSTKDARFYFTLRTDRASKATTVYSQRRYRAASWTHLVATYDGLHMTLYADG
AKVAESSLQTGNLYSPFMKTCRNFFLGSGQLDQSHSFRGLIGGVVLWNYERSHMELLKGP
LQTDPNVPVLAMWADFLKVEQIWTPNKAGLHPAVVPTPVPEPEVVSPYLPPPCGLTPCDN
TDIISGYNNNWQLCAHKRVRYRIVNLCNDDGGSPTVSEGQIQLQHRALTDAFWPYNITFD
LSVHTERNTSLRQQFILNCQIEKIGNRRCDPECDHPRTGHDGGDCLRQGPCAWKRQDGVC
NMECNSIQYDYDDGDCCDPEVTNVVKTCFDPESPDRAYMSVKELKEELHLSGADTLNVFF
ASNSVREELAGAATWPWAKEALTHQGGMVLNPAYFGTVSHQNTMIHEMGHILGLYHVFKG
VSERESCEDPCRETTPSMETGDLCADTAPMPKSKACQDPGAVNDTCGLATYRGTPYSNYM
SYTDDNCTNHFTPNQMARMHCYLDLVYQNWMADGPPASIPLAPAVSGHSLDSVLIHWLPP
VRGPLYPSSSAPLLSCGDCSLDGVFHQYAYEAASPRVCDTSGYWTPDEAVGPPDVEQPCE
PSLQAWSPELSLYDTNVTSPCPDTEGCTLTLTFLHPVVPHALTLWVTYISSNNPAVADIE
LIRDGAQSIHLGPQHVFCDMPLTMRLDTGNTTISAVKLCTFDERLEIDAIMLSSGPGSPL
CSGCSPLRYRVERQPAFTRAPEPQTHRTFTDSSVQQGVKYQYVIQVEADGLLNRFSPPLV
YTHGQPYCGDGLVQGPEDCDDGNLLDGDGCSKKCLMETGFNCKGAPSQCYVFEGDGVCED
FERSSSIQDCGYFTPLGYSDQWASTAAASHQHPERCPAHAVTGEPSLTKLCRFQHLEVSD
RSPSDAWFPCTAQPDTNNDLEYSFWLKVGFVQPGVAASVLVYLASDGSWSGEQCRRTVTI
FLSDTSGTNHSLGTHDLSCHRNPLVVNVNHDLSRPFFLTAGVILRFSSPSVAVRGVALRT
SCHFSTFALTGCASEGGLSHNYISCLHQQPCQTDDCSPPQLQHATVRCSGQGEESRCSVQ
CHHGYSIASRSGRTAPPRQRQTHLKCLHGSWDQTVSCQPTDCGLPDPSYVYHAVFSCPQG
TTFGKQCSFTCRPPAILQGDSDRLVCLEDGLWSFPEAYCKIECAEVPSIPSARLLTADCL
TSGHDIGSVCRYKCNPGFYVTGSLKNKTPRKHFRLACLESGRWEEASCEAVSCPALPDVF
QRMYTCTNSLYYDTRCTLHCQDPAESMEIRCNKDGKWTAEFSMCSGIQGSCPPPPPDLNS
VEYSCEQGTDVGSQCFPTCLVTLDMALWDPVVLPNGTTAAALKHWMLPSKVSSIVCTGMM
KWFPDPQQIHCIQSCEPFGGDGWCDTLNRAYCQYDGGDCCPSTLSTRKVIQFGVDCDHDE
CTCRDPDAEENK
Download sequence
Identical sequences H3C6N9
ENSTNIP00000003910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]