SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003916 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003916
Domain Number 1 Region: 93-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000664
Family Extended AAA-ATPase domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003916   Gene: ENSTNIG00000019840   Transcript: ENSTNIT00000000911
Sequence length 239
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:101332306:101334975:1 gene:ENSTNIG00000019840 transcript:ENSTNIT00000000911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAYPVELLEKSDCLSTCARVYCVTGERLLHSKPQTLGPKPDSLSGPVDQQSLQAKQVLPS
PLDWKSFLSSTKEARLKTDSSCLAMIEAEQGALFEVIRRALQSLRKNKGPIQEQRKEISA
VIQRCYKRYKQYALYKRMTLAAILIQSHFRSFHEKRKFQQSRKAAVLIQQYYRSYRHSLR
HISYPCLLAYSSLLTKKQNQAARKILRFLLRCRHRAKEQRKARGPESSTPGSAHSPISL
Download sequence
Identical sequences H3C6P5
99883.ENSTNIP00000003916 ENSTNIP00000001287 ENSTNIP00000003916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]