SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003921 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003921
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000017
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003921   Gene: ENSTNIG00000001539   Transcript: ENSTNIT00000002122
Sequence length 481
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54326817:54331111:1 gene:ENSTNIG00000001539 transcript:ENSTNIT00000002122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEFATKYFRYRQRISGIYRPAGFGDDSTHTGLPIKESLILYSDPEINNLSVQCFKNLMQ
FMGDVPMARKTSHSDCLRNILLGKEKELLRDEIYCQIIKQTINNSNQNTYFFSYDCVFYK
YPPPLRVIKYNKNFVRCIFIKEAELKRIFTIELSSRYLKFKLIPTVFFKLLSGFVMFPQI
QLYPRLADAQPIVFVLKVAADVIAQICKSMGVSDLEETKEFSLLASRNRDGMVHPLQAQE
YLLDVLADDNSILLSLRRVTWNRPLSFSSDLYVDFHYQQLLSDYLSGQLMLGASSSVQQT
AELSALQHLSQGRMHMPSAGEIKEYLPPQEEVRRNIEEIYTFCVGQVAAMHSLSPQETKI
KFIEILTTLPLFGANIFTAQKVSQRGCPSPCMVSLGQEGVLFLHPTTQERIFVIPLADIQ
SMRAIPAKKKGKFPAVDIYFGNSSRPKKITINLQQGKEFCHTLSLIIISSVLCETKFCQL
S
Download sequence
Identical sequences H3C6Q0
ENSTNIP00000003921 ENSTNIP00000003921 99883.ENSTNIP00000003921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]