SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003924 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003924
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-40
Family Laminin G-like module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003924   Gene: ENSTNIG00000013443   Transcript: ENSTNIT00000000665
Sequence length 1769
Comment pep:known_by_projection chromosome:TETRAODON8:4:5585089:5622271:-1 gene:ENSTNIG00000013443 transcript:ENSTNIT00000000665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEPADLLKILDFHNLPEGVTRTTGFCSHRRSAQGADVAYRVSKNAQLSAPTKQMYPGDA
FPEDFSILALVKPKKGSQSFLLSVYNEQGIQQLGLEVGRSPVFLYEDHTGRPSPEDYPLF
RGVNLADGKWHRVAISVHKQTVTLILDCKKKTTQKLLRSPSPIIDTKGIVVFGTRILDEE
VFEGDIQQLMIVSDHRAAYDYCEHYSPDCDVPAPEQPQNQDPNTDEYNPDGNYYYEYPYY
DDGDDKPKPSHTGINLTSYTGEVTSTSTRASSGGTGSSSSSSSSTATGEETSLNGNDYDY
NYNYESYDDTTALPDEDTSRRVTISTDSGAELDLELKEKTDPAPGTGMHFSTSDLGTSVT
INQNKTELVGGYYNGYDDDGGVDGGGSSSSVVIGTGANTDSSTILFKFDGARGEKGQKGE
PAVIEPGMLVEGPPGPEGPTGLPGPPGSSGPPGTPGDPGERGPPGRPGLPGADGLPGPPG
TVLMLPVRFASFAPNCLHRCETCGQQSRLAEPSEHFVKGLMMHSNITAGIIKGVKKDHAA
LWDPPGPTGKPGRRGRPGADGARGMPGQSGPKGDRGFDGLAGLPGEKGYRGESGPSGPPG
APGEDGERGDDGEIGPRGLPGEPGPRGLLGPKGPQGPPGPPGVTGMDGPSGLKGSIGPQG
EPGPPGQQGNPGAQGLPGPQGAIGPPGDKIPLHYPRGSIPGCDGFTXPPMCCYKLQGPNK
DLSPQGPPGPQGPIGYPGPRGVKGADGVRGLKGNKGEKGEDGFPGFKGDMGIKGDRGELG
AAGPRGEDGPEGPKGRLGPGEAGPLGPTGEKGKLGVPGLPGYPGRQGPKGSQGFQGFPGA
NGEKGTRGTAGKPGPRGQRGPTGPRGERGPRGPTGKAGPKGNSGNDGPPGPPGERGLPGA
HGPTGFPGPKGPPGPPGKDGLPGHPGQRGETKTQGFQGKTGPPGPPGVVGPQGPTGETGP
MGDRGHPGPPGPPGEQGLPGAAGKEGAKGDPGPAGPAGKDGPPGPRGFTGERGLPGPVGA
HGLKGNEGPHGPPGPAGSPGERGPAGPAGPTGLPGRPGPQGPPGPAGEKGGPGEKGPQGP
AGRDGIQGPVGLPGPGGPPGPPGEDGDKGEIGEPGQKGSKGDKGEHVRSPGPTGPQGTVG
APGPAGGPPGPVGLQGLPGPAGEKGETGDVGQMGPPGPPGPRGPAGPPGADGPQGPPGGI
GNPGAVGEKGDAGETGEPGPQGEVGPPGPRGERGEKGEAGPAGAAGPPGPKGPAGDDGPK
GSPGPIGIPGDPGPPGEPGPAGLDGPAGDKGDDGEAGQPGSPGPTGESGPSGPPGKRGPH
GPAGPEGRQGEKGAKGESGLEGPQGKTGPVGPQGSPGKPGPEGLRGIPGPVGEQGLPGSP
GPDGPPGPMGPSGLPGLKGDTGVKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPSGSAGPK
GDTGIAGPSGPLGPVGPPGLPGPPGPKGAKGSSGQTGPKGESGTPGPPGLPGPPGDIIHP
HPIQSSMKGRTRRNIDASQMDDAAADANYKDYDDGMEEIFGSLNSLKLEIEQMKHPLGTQ
SNPARTCKDLQLCHPDFPDGEYWIDPNQGCSRDSFKVYCNFTAGGESCIFPDKKSEGSRV
TSWAKESPGSWFSEFKRGKLINNLSYGDAEGNPIGVVQMTFLRLLSAAGRQNMTYNCYQS
VAWHDQDGDNYDKAIRFLGSNDEEMSYDNNPYIRALADGCALKKGYEKTVLEINTPKVEQ
VPFVDIMFNDFGGSTQKFGFEVGPVCFIG
Download sequence
Identical sequences H3C6Q3
ENSTNIP00000003924 ENSTNIP00000003924 99883.ENSTNIP00000003924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]