SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003942 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003942
Domain Number 1 Region: 241-461
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.44e-72
Family Fibrinogen C-terminal domain-like 0.0000054
Further Details:      
 
Domain Number 2 Region: 55-142
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000785
Family Myosin rod fragments 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003942   Gene: ENSTNIG00000011062   Transcript: ENSTNIT00000003894
Sequence length 464
Comment pep:known_by_projection chromosome:TETRAODON8:15:3999277:4002878:1 gene:ENSTNIG00000011062 transcript:ENSTNIT00000003894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LATLTFCLLVLVATGFPFDKKGGSAAGGASKEKRVQYAAWDDVNVIAHGLLQLGQGLKEH
VDRTKVQMRDISTKLKLFNRTVTDLGKESQKLRAEGEAAKSRARELEDREGQLLNITAEL
REKAEEMQLERRAMSARMSRLEEMLPGAEAGAGNGSDARHIQVMLENQNRRIDDLLERIR
LQQEKLDKQNARIRTLQNQVLESRKGSGTGASEEQSDSPFVPCSTPAPVNPARSSPARDQ
MASDCHELFLRGEATSGVYTIQPVNAQPFKVFCEMTASGGWTVIQRRQDGSVDFDQLWEA
YLRGFGSLNGEFWLGLEKIHSISKDGGHILNIQLSDWNGDVASVTLPFSLGGEETQFSLQ
VRKDGPLSTLERSLGADAHGGLPFSTRDQDNDRKNDTSCAKHLSAGGWWFSSCGHSNLNG
RYFQSPPPKHRHQRKQGIFWKSWRGRYYPLKKSVMMVAPASVQS
Download sequence
Identical sequences H3C6S1
ENSTNIP00000003942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]