SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003980 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003980
Domain Number 1 Region: 51-519
Classification Level Classification E-value
Superfamily Sema domain 6.67e-150
Family Sema domain 0.0000000841
Further Details:      
 
Domain Number 2 Region: 515-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000209
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003980   Gene: ENSTNIG00000009523   Transcript: ENSTNIT00000000344
Sequence length 1103
Comment pep:known_by_projection chromosome:TETRAODON8:5:10048758:10057843:1 gene:ENSTNIG00000009523 transcript:ENSTNIT00000000344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGACVSSELLLLLTASCTLLAVSFPEDSVPLDVVDAHFSRRYPVFRGRPSANESQHRLDF
QLMTKIQDTLFIAGRDQVYLVSLRESYRNEIIPYRKLTWRSGQADRDMCAVKGKHRDECH
NFIKVLVPRNDDLVFICGTNGFNPMCRYYRLDNLEFDGEEISGLARCPFDSKQTNVALFA
EGKLYSATVADFQASDSVIYRSMGDGSALRTIKYDSKWLKEPHFLHAAEYGNYVYFFYRE
IAVEQSSLGKVVYSRVARICKNDVGGSQRVLEKHWTSFVKARLNCSVPGESFFYFDVLQS
ITDIININGVPSVVGVFTTQMNSIPGSAVCAFSMADIEKVFWGRFKEQKTQDSVWTPFPE
EKLPKPRPGSCAGHSPAASFKSSIEFPDDTLQFIKSHPLMDTAVPSLGDEPWFTKTRVRY
RLTALAVDNEAGPHKNYTVVFIGAESGVVLKVLAKTPSVSLDDSLLLEEIDVFNRAKCLS
NREDDKRVLSLHVDKEAHSLYVAFSSCVIRIPLSRCERHSSCHKSCIALRDPYCGWPHSA
CERIQPGVSAEYEQDVESGNTTHLGDCHAFLGSTSAPDYKSFGDPTSDMEFSSTPVTVQP
NGPIHPPVLIPTQSPSSGPDPDHYGSGFVLQDDPATSNTLNSIPGGQEGVWDIQAGETNQ
MVHMNILITCVFAAFLMGALLAGLIVFCYRDSVLRKPRHVHKDTESAPSCSDSTGSFVKL
NGLFDSPVKEYQTNIDTPKLFTNLLTNSKDLNTPNSDTKTMILRDSCQPPELAALPTPES
TPVLQQKGLQPITNQWERAQGKVSGPRKESNSSAKSPQFLPAPALLNPKSHQGHIALGHS
HIPSAVVLPNATHELSNMDGGSDTLPHSSEKRLKNPDSKGSRKDPKRSVDARNTLNDLLK
HLNDSVANPKAILQEEPGPRPRQHLTLEPMDELTEIPPVVPSREASLYSPSSSLPRHSPT
KRVDVPLPTTPTTPTGSLSMGGTLERQRGGYQLHRSASHRHSLSTSQNGVTMGVSVSRQH
SMNRGGCMPPTPPSRIDSHSGVMGPGMHSPHSSISRQNSYNGHCSLPRTGLKRTPSLKPD
VPPKPNGFSPQTSQMRVVNKYNY
Download sequence
Identical sequences H3C6V9
ENSTNIP00000003980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]