SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004012 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004012
Domain Number 1 Region: 23-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-38
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 147-261
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004012   Gene: ENSTNIG00000014886   Transcript: ENSTNIT00000000113
Sequence length 261
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:2325096:2327351:-1 gene:ENSTNIG00000014886 transcript:ENSTNIT00000000113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEEEVERFFFSFFFFSDHKGFKCGGILSAPSSNISSPNFPSPYPYNSDCSWLIVVAEGSS
VHLTFHHFELEYHASCSYDYIKIYNGVAEDEGNLLGMFCGDVSPPQFTSSWNVMSIIFHS
DRHVAYRGFSVGYRKVKGKELLCFTGECQQVLSAVSGTFSSPRFPNIYPNNINCHWGITQ
AAGYRVKLFFPFMDLEDQNSLSGECDYDSVTVYDGDSQTDAVLGRWCGRERPPSLISRSN
KLLVVLRTDRNGAYRGFTAAY
Download sequence
Identical sequences H3C6Z1
ENSTNIP00000004012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]