SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004020 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004020
Domain Number 1 Region: 44-170
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-24
Family Cadherin 0.00016
Further Details:      
 
Domain Number 2 Region: 157-263
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000371
Family Cadherin 0.0041
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000286
Family Cadherin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004020   Gene: ENSTNIG00000000623   Transcript: ENSTNIT00000001778
Sequence length 301
Comment pep:known_by_projection chromosome:TETRAODON8:13:1836604:1868874:1 gene:ENSTNIG00000000623 transcript:ENSTNIT00000001778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAVVKPLDYEGTAFHTLLIKVENEDPLISNIGYGPSSTATVYVTVLDINEGPIFFPDPL
TVILMENIPVGSFVASLNATDPDILQMQSIRYSVLHDPAGWLSVNPVKGTVNTSAPLDRE
SPYVRDSKYTAVFIATDNGMPSATGTGTLVIHLLDYNDNAPYVVPSVARVCEDAHDMNVA
IVGGRDRDLTPNAAPFKIELGKQPGLDKTWKITRVNSTHSQIMLLHSLKKANYQLPLLIT
DSGEPPLSNSTEVKVQVCVCKKNKMHCSSASSLRGGLLTLLATFLLPLLSCSASLVAIHL
E
Download sequence
Identical sequences H3C6Z9
ENSTNIP00000003363 99883.ENSTNIP00000004020 ENSTNIP00000004020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]