SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004033 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004033
Domain Number 1 Region: 8-146
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-39
Family C-type lectin domain 0.0000765
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004033   Gene: ENSTNIG00000000500   Transcript: ENSTNIT00000003809
Sequence length 148
Comment pep:novel chromosome:TETRAODON8:18:1819969:1820539:1 gene:ENSTNIG00000000500 transcript:ENSTNIT00000003809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEFALSVFCPARQGWVYFGGNLYQVSSTKKSWGESRRDCQQKGADLLIINSREEQQSWE
SFLSCFKKVFANQFKKYMWIGLTDVATDGVWKWVDGTKVSTSYWSSGEPNGKKSENCADI
KNHGTELSWNDESCSISLFWICEKRFLQ
Download sequence
Identical sequences H3C712
99883.ENSTNIP00000004033 ENSTNIP00000004033 ENSTNIP00000004033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]