SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004034 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004034
Domain Number 1 Region: 43-230
Classification Level Classification E-value
Superfamily Ankyrin repeat 7e-41
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 268-327
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000227
Family SAM (sterile alpha motif) domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004034   Gene: ENSTNIG00000016062   Transcript: ENSTNIT00000000383
Sequence length 473
Comment pep:known_by_projection chromosome:TETRAODON8:13:11155643:11166246:-1 gene:ENSTNIG00000016062 transcript:ENSTNIT00000000383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRTFPAGEENEDSGDEWDIGISYEKTSFVQDLDAVASGKDDVMLKRAITNGDTETVRQL
LDKGLDVEMRLDFGWTPMCAVSVADYNVAELLLERGADASFHKDGWSVLMACITASAQED
RITRCVELLLSRNADPNVADRSQMTCLMLAAKRGHAKVINLLMVFGAEINAQDSYGYTAL
SIAVQHRRQEAVLKLLQLGADKTIRTNTGKCPADLAAIFKNTEMSKILASSQPISASQAS
SSMENTLSQFFATSGEVSSAKECGRKLDELQLLLHGLDLGSLTDIMAKNDITWSHLLSMD
KEDLEEIGVTDPGDQQKVLDALRQMNLGKVDLETIDRFGGADSGCERRREFATSRGARSC
ATSXTIQDVIGRIPCHPSKIAFALDPEKEAQTLCNQLVIQTGDLQKEVTCLRKLLCQLDH
EECCQPPPPEPCGPWGRQVLSGAALGVLGATCLLVLYGATSGKLNLRVCRNPC
Download sequence
Identical sequences H3C713
ENSTNIP00000004034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]