SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004045 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004045
Domain Number 1 Region: 26-158
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000000385
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 2 Region: 287-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004045   Gene: ENSTNIG00000000952   Transcript: ENSTNIT00000004177
Sequence length 353
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:53216653:53218283:-1 gene:ENSTNIG00000000952 transcript:ENSTNIT00000004177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWSWACLWTSLSAVLSSGAAQPPYYRLLQNQVGFQQAAEACSPGLLASLATQQEKDQV
LDLISRSVSPPIHTNLTFWVGLRKANNECMVPVLPLRGFKWTSDGSDVTQVSRWAEEPAH
TCTSVLCAALTLRVNGSALAGWGLISVGCKSRHPFICKQKEPPAPTGPGLEPTSAEAEPH
PPSPTPDPQEPEGPVSRPDSFNGSQQDPGPGRCPLPSSSVTRSLIPDPIDPGRIQVECWT
AEVLVEVRCSGQPRLWRLLDGSVVNFSSVCVPCEDGFQKSSWGMCEDVDECQTGAPCRRS
CLNTPGSYRCVCTDETGAVVSEDSSTCKDAAGDPNRGAGAGLLVPVLVALAYW
Download sequence
Identical sequences H3C724
ENSTNIP00000004045 ENSTNIP00000004045 99883.ENSTNIP00000004045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]