SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004046 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004046
Domain Number 1 Region: 1226-1496
Classification Level Classification E-value
Superfamily NHL repeat 0.000000000000191
Family NHL repeat 0.0081
Further Details:      
 
Domain Number 2 Region: 634-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004046
Domain Number - Region: 764-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 734-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000768
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 667-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family Integrin beta EGF-like domains 0.086
Further Details:      
 
Domain Number - Region: 600-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 801-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00461
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 701-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0635
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004046   Gene: ENSTNIG00000019040   Transcript: ENSTNIT00000003111
Sequence length 2754
Comment pep:known_by_projection chromosome:TETRAODON8:16:5682465:5751760:-1 gene:ENSTNIG00000019040 transcript:ENSTNIT00000003111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKERRPYRSLTARQDTEHRYTSSSADSEDGKANPKSYSSSETLKAFDHDSRMAYGSRV
KEMVHHEVDEFSRQGVDFSLRNLGFGEALPSHVATYRSDMGLPHRDYSVSAGSDPDTETD
GIMSPEHAVRLWGRSNTKSGRSSCLSSRANSNLTLTDTEHENTENVKSHEGAFQNHSRLR
TPPLPLSHSHSPSHQHHAASINSLNRSNYTQRSNPSPAPTDSSVPPEGPASQDSVSVQDN
WLLNSNIPLETRNIAKQSFLETLQDNLIEMDILASSGRDASYNDGQFLFKPGGTSPMYCT
TSPGYPLTSSTVYSPPPRPLPRNTFSRPAFSLKKPYKHCNWKCAALSAILISVMLLFLLA
YFIAMHLFGLNWHLQPVQRQMYQLSEDNTSGLPFPTDLSVSPVGNTGLVIPERRGKDDSK
LDSLFPDDSYIDMGEIDVGRKVTQQIPPGVFWRSQVFIDHPMYVKFNVSLSKDALVGIYG
RRGLPPSHTQQFDFVELLDGRRLLVQDIRGVEGPAAMQRGLIPITTHDTGFIQYMDSGIW
HLAIYNDGKETETVSFLTTATDSIDDCPSNCFMNGDCIAGKCHCFLGFKGPDCGRAACPV
LCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDIACSNHGTCIVGTCICNPGYKGENCEE
VDCMDPTCSGRGVCVQGECHCFVGWGGSGCESPRASCMDQCSGHGAFLADTGTCSCDPNW
TGHDCSTEICAADCGGHGVCVSGSCRCDDGWMGSGCDQRACHPRCNEHGTCKDGKCECSP
GWNGEHCTIAHYLDKVVKEGCPGLCNGNGRCTLGNNGWYCVCQLGWRGTGCDTSMETACT
DVKDNDGDGLVDCMDPDCCLQATCHTTALCVGSPDPLDIIQETQLSSTQSKLQTFYERVR
FLVGRDSTHVIPGVNPFDGKHCCFPLMSIPNTGAVFVSTSWVEHKLSGYSCPATDGSFDL
VTNGGIAVALHFERAPFITQEHTLWLPWGRFFVMDTIVMRHEENDIPSCDVSSFSRPSPL
VSPASLTAFAGSCSERRSVVPEIQEEESANTQESDMKFSYLSSRTAGYKSLLRVTLTHST
IPFNLMKVHLMVAVEGRLFRKWFPAAPNLSYDFVWDKADVYSQKVYGLSEVFVSVGFEYE
SCPDFILWEKRAAVLQGYETTASKLGGWTVDKHHALNIQSGILHMGNGENVFISQQPPVI
GSVMGNGRRRSISCPSCNGLADGNKLLAPVALACGSDGSLYVGDFNYVRRIFTTGNVTSV
LELRNKDFRPIGKKHSIYLNKYRKSVYCAETNTLELYTGKLIVFIFCVSSTTLIIHGVLF
GLDYRCLCAVLKTNPPRSITVDKYGVIFFVDGTMIRRIDQNGIISTLLGFNDLTSARPLS
CDAVMDISQVRLEWPTDLAVSPLDNSLYVLDNNVVLQISENHQVRIVAGRPIHCQVPGID
HFIMSKVAIHATLESANALAVSHTGILYIAESDEKKINRVRQVSTNGEIFLVAGAPSGCD
CGQELAVMTYHGSSGLLATKTNKQQSSIYLQASKINLVIDSTNCPVHFFTHNKPYRNIRH
SICLKTPVQSVWPILESQHERIRTELFPLQNFDIMEAARNIGSQKYKRYVNEMKTIWPLV
IQVATNWLICRQRRSDPASLRIRSSVLRFHALIIRFFFSSGSFVMCVSFNISLMLTSCYK
VYDSYGRLTNVTYPTGQVSSYRTDADSSVRIQTEGSNKENITVTTNLSASGTFYTLMQDQ
VRNSYFIGLDGSLRLVLANGMEVSLHTEPHLLAGTIIPTVSKRNITLAIDNGLNLVEWRQ
RKEQARGQVTVYGRRLRVHNRNLLSLDFDRITRTEKVYDDHRKFTLRIHYDHAGRPTLWA
PSSRLNGVNVTYSPGGNVAGIQRGTMSVRMEYDQTGRITSQIFADGKSWTYTYLEKSMVL
LLYSQRQYIFEFDKNDRLSSVTMPNVARHTLETSRSIGYYRTTYQPPEGNASVLQDYSEE
GQLLQTTYLGTGRRVTYKYGKIAKLLEMLYDTTRIGFYYDELTGMLKTVNLQSEGFTCTV
RYRQIGPLIDRQIFRFSEEGMVNARLDYVYDNSFRVTSMQAVINETPLPIDLYRYDDVSG
KTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRVKEVQYEIFRSLMYWMMVQYDNMGR
VVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLLSPGNSARLT
PLRYDNRDRITRLGDVQYRMDEDGFLKQRGNDYFEYNSAGLLVRVYNKVSGWSIQYRYDG
LGRRVSSRSSIGHHLQFFYADLSSPTRITHMYNHSSSEIASLYYDLQGHLFAMELSSGDE
FYVACDNIGTPLAVFSGAGIMIKQILHTAFGEVYLDTNPSFQLIIGYQGGLYEPLSRLVH
MGKRDYDVLAGRWTTPNLEIWKRLNSKHIAPFNMYMFKNNNPLSNNEEIKCYMTDVNSWL
VTFGFQLYNVIPGYHKPNTESMEPSYELVRTQIKTQEWDSTKSLLGVQCEVQRQLKAFVK
LERFGQIYGAKSAGCPQTETKHIFATMGSIFGKGVKFAIREGRVSTDIISLANEDGRRMA
AVLNDAFYLEHLHFTVAGMDTHYFVKMGPVEGDLSLIGMTVGQRTLETGVNVTVSQVNAV
LNGRTRRITDIQLQYGTLYLNTRYGSSVDEEKARILEMARQRAVTQAWARERQRLRDGEE
GSRTWTEGEKQQLLGSGKVQGYDGYYVVSVDQYPELADSVNNIHFMRQTEMGRR
Download sequence
Identical sequences H3C725
ENSTNIP00000004046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]