SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004105 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004105
Domain Number 1 Region: 1867-2113
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 856-989
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000471
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 3 Region: 515-646
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000149
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 289-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000832
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 628-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000138
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 452-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000693
Family EGF-type module 0.00099
Further Details:      
 
Domain Number 7 Region: 754-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000652
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 8 Region: 1115-1229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000102
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 177-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000104
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 10 Region: 974-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000148
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 257-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000554
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 13 Region: 219-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000224
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 14 Region: 142-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000371
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 15 Region: 1240-1281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000464
Family EGF-type module 0.015
Further Details:      
 
Domain Number 16 Region: 831-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 1394-1431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.015
Further Details:      
 
Domain Number 18 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000254
Family EGF-type module 0.013
Further Details:      
 
Domain Number 19 Region: 1312-1356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000457
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 1533-1565
Classification Level Classification E-value
Superfamily Notch domain 0.000000222
Family Notch domain 0.0037
Further Details:      
 
Domain Number 21 Region: 1453-1484
Classification Level Classification E-value
Superfamily Notch domain 0.00000034
Family Notch domain 0.00046
Further Details:      
 
Domain Number 22 Region: 1493-1526
Classification Level Classification E-value
Superfamily Notch domain 0.000000353
Family Notch domain 0.0054
Further Details:      
 
Domain Number 23 Region: 61-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family EGF-type module 0.011
Further Details:      
 
Domain Number 24 Region: 1271-1315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 25 Region: 1354-1391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000205
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004105
Domain Number - Region: 27-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 494-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004105   Gene: ENSTNIG00000007203   Transcript: ENSTNIT00000001662
Sequence length 2476
Comment pep:known_by_projection chromosome:TETRAODON8:4:7162532:7185745:1 gene:ENSTNIG00000007203 transcript:ENSTNIT00000001662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARLKVFLSISPMSLICSTGLKCSLPTESCLNGGRCEANANGNGECRCPSDFVGNRCQYP
SPCSPSPCRNGGECRAVSHGNTFDFRCVCRLGFTDRLCLTPTNHACMSSPCRNGGTCELI
TLTAYRCRCPPGWSGKTCQIANPCASNPCANGGQCSAFDSTYICTCPPAFHGQTCKQDVN
ECAQTPSPCLNGGVCVNEVGSYHCRCPSEYTGQHCETAYMPCSPSPCQNGGTCIQKGDTT
FNCICLPGFTGEHCEHNIDDCPGHSCQNGGVCVDGVNTYNCQCPPHYTGQYCTENVDECE
LMPNACQNGGTCHDTHGSYHCVCVNGWMGDDCSENIDDCASAACYHGATCHDRVASFFCE
CPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDECSLGA
NPCEHGGRCINTKGSFQCKCLQGYEGPRCEMDVNECMSNPCHNDATCLDQIGGFHCICMP
GYEGVFCHINIDECASQPCLNNGKCVDKINSFHCECPKGFSGNLCQVDIDECASTPCKNG
AKCTDGPNKYTCECAEGYTGQHCEIDINECYSDPCHYGTCKDGLASFTCFCRPGYTGRLC
ETNINECLSQPCKNGGTCQDRENTYVCICPKGTAGFNCEVNLDDCKSKPCDYGRCIDKIN
GYECACEPGYTGAMCNININDCAINPCHNGGTCVDGINSFTCLCPEGYNDATCLSQVDEC
RSNPCIHGRCQDLINGYKCACDSGWSGPNCDINNNECESNPCMNGGTCKDMTSGYHCTCR
VGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLENIGENCETLLAPCSPRPCKN
GGVCKEAEDYQSFSCICPEGWQGQTCEIDINECVKNPCHNAAVCHNTMGGYQCQCQPGYT
GLKCEIDTDDCKPNPCSNGGLCLDGVNSFTCTCPPGFRGGRCEQDINECESNPCKNGANC
TDCVNSYTCTCPLGFSGINCEINTNDCTDSSCFNGGTCVDGINAFTCLCLPGFTGSYCQY
DINECDSKPCLNGGTCLDSYGTYKCTCPLGYTGVNCQNLVRWCDSSPCKNGGSCWQQGAS
YTCQCQTGWTGLYCDIPSVSCEVAAKQQGIDVAHLCRNSGQCLDAGSTHYCRCQAGYTGS
YCQEQVDECSPNPCQNGATCTDYLGGYSCECVPGYHGINCSKEINECQSQPCQNGGTCID
LVNTYKCSCPRGTQGPSEGVHCEINLDDCTPFTDPLTNEPKCFNNGKCVDRIGGYQCMCL
PGYVGERCEGDVNECLSDPCDPRGSYNCIQLTNSYRCECRTGYTGQRCDKVFDGCKGRPC
RNGGTCAVASNTPHGFICKCPPGFTGSSCEYNSRSCGALNCRNGGTCVSGHLGPRCLCPA
TFTGPECQTPTDSLCISNPCYNGGTCQITPDVPFFRCSCPSNFNGLLCHILDYSFVGGFG
RDITPPPEVEVSCEIPQCDEWAGNHICDSLCNNHACGWDGGDCSLNFDDPWQNCSAALQC
WRYFNDGKCDGQCNSPGCLYDGFDCQGQEGQCNPLYDQYCKDHYADGHCDQGCNNAECEW
DGLDCANNMPEKLADGHLVLVVHIPPEQLKNRSSAFLRELSSVLHTNVVFRRDAKGEPMV
FPYYGNEQDLVKHNVLKRSADGWPDWASMPADVLGQRKRRELDPLQVKGSVVYLEIDNRQ
CYQQSTECFQSATDVAAFLGALASSGNLNVPYIEAVTRLSNGVRPTSPGSELYPMYIVFL
GLAALGFICLGVLVSRKRKREHGQLWFPEGFKVSEPSKKKRREPLGEDSVGLRPMKNSDI
NLMDDNQIEWDDEDPDCRRLRLEEQAMLDLCDHGDPRKWTQQHLDAADLRIACIAPTPPQ
GEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDPSAEIITDFIYQGANLHNQ
TDRTGETALHLAARYARSDAAKRLLESSADANVQDNMGRTPLHSAVAADAQGVFQILIRN
RATDLDARMHDGTTPLILAARLAVDGMVEELINCHADVNATDDSGKSALHWASAVNNVEA
AVVLLKNGANKDMQDNKEETPLFLAAREGSYQTAKVLLEHFANREITDHLDQLPRDIAQE
RMHHDIVRLLDEYNVVRSPGLHNAPLNTSSLSPPLASPNDYLSNLKPSMSVKKVRKLTSG
GKGGKDGGKDGRNKKKKSVDGKGNLLDTSAVLSPVESLESPHGYLSDVASPPMASPFQQS
PPISLNHLQGTGDLLGMNAGKDVGCMSFDPNPPRLSHLPVSSPHSQGAASLGGSRGGQCD
WVSRMHPGVSQQGNFTQAPTMTHNIMSALHGVTTATLSQIMGYQNLQTSHLGSPAHMIQQ
AHSQQLQHQNTNSNPAAGPPLNQSCPNIELNGSEMQQSNSSGHVMTIHTVMPQETQILGT
QFLTPPSQHSYSGPMDNTPNHQLQVPDHPFLTPSPGSPDQWSSSSPHSNMSDWSEGISSP
PTSIHSQVNLIPDQFK
Download sequence
Identical sequences H3C784
ENSTNIP00000004105 ENSTNIP00000003225 99883.ENSTNIP00000004105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]