SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004227 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004227
Domain Number 1 Region: 86-214
Classification Level Classification E-value
Superfamily Cadherin-like 2e-29
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 45-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000222
Family Cadherin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004227   Gene: ENSTNIG00000001853   Transcript: ENSTNIT00000004362
Sequence length 249
Comment pep:novel chromosome:TETRAODON8:Un_random:44833043:44833944:1 gene:ENSTNIG00000001853 transcript:ENSTNIT00000004362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRAPAEGPSGGPLWPIVSFGPQNRPPLVWRLLVVLTGWCLCVGIIKLRRSPPPRLRGPQY
TLNITATDDNASGGPFPLSSSAQVIVGINDVNNNKPVFLECHNYSQRAVVLENQPPGTGV
LRVQAQDADLGVNGQVKYGIMHRDGVSSGFHIDPDAGYITTTVSFDRERQREFTLSVTAT
DQADEPLIGICQITVLVADQNDNEPKFENSRYQCEYRRRSLSLRLSAAGPRRRPRPPLLN
QTRSPAASE
Download sequence
Identical sequences H3C7K5
ENSTNIP00000004227 99883.ENSTNIP00000004227 ENSTNIP00000004227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]