SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004252 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004252
Domain Number 1 Region: 41-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 181-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000132
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 3 Region: 3-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004252
Domain Number - Region: 111-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Laminin-type module 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004252   Gene: ENSTNIG00000001877   Transcript: ENSTNIT00000004387
Sequence length 255
Comment pep:novel chromosome:TETRAODON8:Un_random:101736769:101738788:-1 gene:ENSTNIG00000001877 transcript:ENSTNIT00000004387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFSCECEHNTCGESCDRCCPGYHQQAWMAGTFHARHICEKCNCHGKAEECHFNQTVADLS
LSLDIHGQRRGGGVCVGCRDYTAGINCETCIPGFYRPAGVSADEDNPCIPCSCDLRGSAS
QSCVPNSNQATSSQPPGSCWCKEGFGGLLSVILCAVGYMGFPFCQPCNCSIDGSTNKDPC
VTPCVCKENVEGENCDRCKVGFYNLQRYNQRGCEKCSCMGVSSHCTESSWTYQNVGNRII
GSIYESEKRFIEMHQ
Download sequence
Identical sequences H3C7N0
99883.ENSTNIP00000004252 ENSTNIP00000004252 ENSTNIP00000004252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]