SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004264 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004264
Domain Number 1 Region: 428-668
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-75
Family Fibrinogen C-terminal domain-like 0.000000449
Further Details:      
 
Domain Number 2 Region: 42-231
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 6.05e-62
Family Fibrinogen coiled-coil and central regions 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004264   Gene: ENSTNIG00000001888   Transcript: ENSTNIT00000004401
Sequence length 670
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:45254887:45258899:-1 gene:ENSTNIG00000001888 transcript:ENSTNIT00000004401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRFPSAVLCCFCASAAWLNFRAGSLDPRGARPVEPSTRSENCPSKKEWPFCSDDDWGPKC
PSGCRIQGLMDKHDFSLLKKIEKIRNLLDQNKAKFRTADQASKQTYDYLKDKLTLDSDNS
NKYYALAQNLRRNINDMKIKIDAQLRALAALKDRVRDQVSEMQRLEVDIDIKLRSCKGSC
ERYSAYQMEVGSYVALEKQLKQLDSPSSQSVKGVETLYVMKSRPLKDDPVDSLFKAKDLD
GQQKEDVFHEINTVTLLLEQEGSSSSPATVSKVPGTSFSPSIASSSSASSSKPITELSGP
QDGGLFDGQFDGLSSKTHLSTQTTSCTRFIKTTLVQTAKGPIKEEEEVMKGGPECQTFRD
LSKGELTSLFPTLTLTIHTGGTKQSQLGVSEPGLVNPFDLGAFMMANAEDDVPDLQARSV
KTTRVERKADYVGKDCVEAHQYHLKGESNGLFKIRLGGTKPAQVVEVYCQQEGLMGGWLL
VQQRESGEVSFNRSWAEYRSGFGSVGADGRGEFWLGNQNFHWLTSQSETLLRVEMEDWEG
GAATAEYTVRLGSEEEAFSLHVSGYAGDGGDALLLPGSHMAPFLSHNRMKFSTFDKDNDE
WEQSCAQVHGGGWWYNRCQAANLNGVYYQSANAPENEPAFPGPNGVVWSTFRNSSSSLKA
VRMLIRPAAF
Download sequence
Identical sequences H3C7P2
99883.ENSTNIP00000004264 ENSTNIP00000004264 ENSTNIP00000004264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]