SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004278 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004278
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.53e-82
Family BAR domain 0.00055
Further Details:      
 
Domain Number 2 Region: 400-516
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.7e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 260-363
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-28
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 622-740
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.54e-26
Family Ankyrin repeat 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004278   Gene: ENSTNIG00000015565   Transcript: ENSTNIT00000004416
Sequence length 790
Comment pep:known_by_projection chromosome:TETRAODON8:1:16746751:16766620:1 gene:ENSTNIG00000015565 transcript:ENSTNIT00000004416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITVDFEECLKDSPRFRATVEEVEGDVCELESKLDKLVKLCISMIDAGKAYNAANKQFV
NGIRELAQQSTTDEVIESSLTKFAESLQEMINYHTILFDQAQRSIKTQLQTFVKDDLRKF
KEAKKQFDKVSEEKEAALIKNAQAPRNKQHEVEEATNILSATRKCFRNIVLDYVLQINVL
QSKRRSEILKSMLSFMYAHLTFFHQGYDLFSELHPLMKLLGGQLDQLVVDAAKEKRDMEQ
KHCTIQQKDFSNDDTRLEYNVDTDNGIAMEGYLFKRASNAFKTWNRRWFSIQNNQLVYRK
KFKDTPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCILQADSEKLRQAWIKAVQNSI
ATAFRDKGEDAEKLDRKSSTSTGSLDSGGEPKERSLKGESALQKVLAIPGNACCCDCGQP
DPRWASINLGITLCIQCSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNGVINQIYE
ARREELGARKPQPGDPRQEVESYIKAKYVERRLVRRPSDEQLRTKVVSLSKQEKRLSTSS
EHLPPRPPPPTPKLRPGSNASAVFSASIKSADSGIQNSADGSREVLTDVPADGNNLPEAG
RTPRAGERVFYEPKEYSPGLQLYWASFARSLPDMAEALAHGAEVNWVNTEDDKRTPLMMA
VQGGSLVTCEFLLQNAANVNQQDAQGRGPLHHATMLGHTGQVCLFLKRGANQNAADIDER
TPLTIAVEAANADIVTLLRLAKMNEEMREAEGPYSQSGDETYQDIFQDFTHMASNDPDKL
NRYQQYDPQS
Download sequence
Identical sequences H3C7Q6
ENSTNIP00000004278 ENSTNIP00000004278 99883.ENSTNIP00000004278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]