SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004320 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004320
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.62e-55
Family N-terminal domain of cbl (N-cbl) 0.00000165
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 1.07e-46
Family SH2 domain 0.00000464
Further Details:      
 
Domain Number 3 Region: 350-426
Classification Level Classification E-value
Superfamily RING/U-box 1.08e-41
Family RING finger domain, C3HC4 0.0000122
Further Details:      
 
Domain Number 4 Region: 170-255
Classification Level Classification E-value
Superfamily EF-hand 1.59e-36
Family EF-hand modules in multidomain proteins 0.0000104
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004320
Domain Number - Region: 844-899
Classification Level Classification E-value
Superfamily UBA-like 0.000157
Family UBA domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004320   Gene: ENSTNIG00000008592   Transcript: ENSTNIT00000004458
Sequence length 910
Comment pep:known_by_projection chromosome:TETRAODON8:7:2028216:2050439:-1 gene:ENSTNIG00000008592 transcript:ENSTNIT00000004458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALNGRNPGGRGPNRSKGRILGIIDAIQDAVGPPKQPAADRRTVEKTWKLMDKVVRLC
QNPRLQLKNSPPYILDILPDAYQHLRLILGKYEENQRLTQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGQFQGDTFRITKAEAAD
FWRNFFGEKTIVPWKVFRQCLHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLHKYNNKPGSYIFRLSCTRLGQWAIGYV
TSDGSILQTIPHNKPLFLALIDGYREGFYLFPDGRSYNPDLTGLCQPTTHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDIKIEPCGHLMCTLCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRNEGAKCFFLDQHSCPMLELDDDEDRDDCLVMNGLANMRKHCAERQNSPMVS
PSSSPVSQHRKAHGGELGHCVQHLGLPPVPPRLDLIQKSAMRSPSASPTCSPKSSPGMSR
KQDKPLPAPPPPQRDPPPPPLPPERPPPIPPESRHSWFPSSSSSSSGTSLESQKKSDTPC
PKDSHLDAPLGLGGPSHLNGRPSFSGSGLILLTIHMLHHTDGDERKQVQPVSNGVQQSDD
YDVPPSRHSPTQSLLSSCQTPANSFSTAVVGQEEGEDDYQVPSSSLCLRQAPVCISVPQR
YSQCVLLTKLIGNNQRLQRSFSTCHPLVSAIEDPFQSCPPSGPPPPPPPMRHSFIDLTRP
HRPSSGQDQLLLTPADTVLDMLSSAAPLPPVRRHTENVKGSRGRLEYDHIPAHAGCLQAP
ARPPKPLPRTQPGKSHSPESENVDAKIAKLMGEGYSFEDVKRALMIAQYKVDVARNILRE
FVLVVPRLNI
Download sequence
Identical sequences H3C7U8
ENSTNIP00000004320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]