SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004375 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004375
Domain Number 1 Region: 14-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-24
Family Laminin G-like module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004375   Gene: ENSTNIG00000001976   Transcript: ENSTNIT00000004514
Sequence length 206
Comment pep:novel chromosome:TETRAODON8:Un_random:46518405:46519276:-1 gene:ENSTNIG00000001976 transcript:ENSTNIT00000004514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVYKNNDVRLELSRLAKQGDPKMKVSGVVSFKCESVATLDPVTFDTPESFVALNKWTAKK
AGSISFDFRTTEPNGLMLFSHGKPRQQQRKDSRTPPTVKVDSFAIEMLDGHLYLLLDMGS
GTTKTKAIDRKVNDGEWYHVDFQRDGRSGTGHQDQVPGHGLTLALTLTLTLTSTMTLTLT
MTPTLALTMTVTLILVFALVLKLTRP
Download sequence
Identical sequences H3C803
99883.ENSTNIP00000004375 ENSTNIP00000004375 ENSTNIP00000004375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]