SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004387 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004387
Domain Number 1 Region: 11-230
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.77e-46
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 314-357
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000235
Family SOCS box-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004387   Gene: ENSTNIG00000001985   Transcript: ENSTNIT00000004526
Sequence length 362
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:46621418:46623188:-1 gene:ENSTNIG00000001985 transcript:ENSTNIT00000004526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYWLPGYKLEKSWAMAVHVCVMYNAVETALLLLERRTVNAMPNGKTPLHVACEMSDADCV
ALLLAHGAKVNSLSLSGHTPLHYCITARSVDCAKQLILKGLHVNAPSQNSSEDTPLHTAA
RFGIPELVALYLAHGASVDALNSQQETPLMTAAFWAFDSKEQTYSQDHHVVCRLLLDHRA
DPNLQEEDHKTALHKASWNCDHVLMQMLLEAGADARAMDINGCAPIQYLLKVTLRPTAIP
ELCFQLLLNHNAARVYPPQFHKVLQCCHDHPRVIEVMVNSYERLKPTRKWRAAIPDDCYK
RHEDFYRSVFAVCADAPRSLLHLARCAIRSCLGAFCHRGAARLPLPPGMKKYLLLDPEGV
LY
Download sequence
Identical sequences H3C815
ENSTNIP00000004387 99883.ENSTNIP00000004387 ENSTNIP00000004387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]