SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004416 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004416
Domain Number 1 Region: 227-368
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-36
Family Third domain of FERM 0.00078
Further Details:      
 
Domain Number 2 Region: 119-229
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-33
Family Second domain of FERM 0.0000985
Further Details:      
 
Domain Number 3 Region: 41-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-24
Family First domain of FERM 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004416   Gene: ENSTNIG00000007569   Transcript: ENSTNIT00000004556
Sequence length 789
Comment pep:known_by_projection chromosome:TETRAODON8:2:17990829:18006174:-1 gene:ENSTNIG00000007569 transcript:ENSTNIT00000004556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFLRRTLGRRSIRKHAEKTRLREAQRASTHIPAAGEAKSIITCRVSLLDGTDVSVDLP
KKAKGEELFDQIMYHLDLVEKDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHMRV
KFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFDTAVELAAFSLQAELGDCDPLEHN
LDLVSEFRFIPQTEEVELAIYNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARD
GNEYSLGLTPTGVLVFEGATKIGLFFWPKITCLDFKKSKLTLVVVEDDEQGKEQEHTFVF
RMDHPKACKHLWKCAVEHNAFFRLRGPVQKNSARSGFIRMGSRFRYSGKTEYQTTKASKA
RRSASFERRPSRRYSRRTMQNRGENTRGKGNGVSSSKDKPSFIRGAWSAVPVVSPVAASA
CGPMEIEALPRSPGPRKEKLCSVPSVSELIETCVDDVLKAPGLPAAMAADEAGPSSPYAA
PSATGEDSLSLSEAAARLKQLELEISPLPVTPRNNINVNVALNNQVSIQSFCLYSEDVVK
ITEKCSLSSTASSSPGATPLRTPEDLKSNILKAQAEAAAVMAPSEEHVVIVGDKNCNVQD
ASVRLKARAGRMGSNSSLSVSGRPDLQESWDLLKPALSFCAAGVSAEKLTEDPNTSAPSM
PSESVSESLAPKVKTEDVDPQSAAPVSVNLIDFTDLTPVLPPVHQPKPVITPRWIIPTTA
PPGVFTNSMLDVDQPAKVNPVFTADGRAANPPALAHLTPPPNPVISSAVGQHPTPEDGAR
PRGLLTTEL
Download sequence
Identical sequences H3C844
ENSTNIP00000004416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]