SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004425 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000004425
Domain Number - Region: 792-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 312-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 69-212
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number - Region: 264-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0711
Family Laminin-type module 0.047
Further Details:      
 
Domain Number - Region: 495-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0711
Family Laminin-type module 0.035
Further Details:      
 
Domain Number - Region: 530-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0743
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 704-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0823
Family Laminin-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004425   Gene: ENSTNIG00000014800   Transcript: ENSTNIT00000004565
Sequence length 842
Comment pep:novel chromosome:TETRAODON8:11:4776856:4781775:1 gene:ENSTNIG00000014800 transcript:ENSTNIT00000004565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGAGCAHPCNCSGAVCDPVTGGCKCPAGTSGEHCENLCPEGSWGPGCTQTCPVCENGGVC
HKHNGSCICPPGFMGRLCQNTCPSGRFGQGCQMKCICENNARCDVASGRCTCAPGWTGHN
CRKACDAGRWGTDCAETCDCRNGDGSCDPVTGQCNCEAGYTGDKCQQKCPTGMFGFGCRH
RCQCDNKALCDHVSGACTCQSGWTGTFCEKPCPRGFYGLDCQEKCLCLNGGSCNHVSGHC
SCPAGWIGRSCNLTCPPGSYGGGCNQTCSCRNSGICHPASGQCACTPGWTGPNCTEECPA
GFYGADCLQRCLCQNGATCNKSNGTCACTSGWTGAACELECDVGQFGADCQQQCHCENGG
QCDRQTGRCSCSGGWIGERCERACDPGLFGAGCEARCRCARGASCNHVTGECRCPAGWRG
KLCDKACLPGSYGTDCVQRCSCPRGASCHHISGECGCPPGLMGNGCEQIRLVFPGTFWNT
TVNPGLLSQCSGGPNQTSCHPASGRCYCAPGFDGPRCDRICKEGRYGPGCEGECRCENGG
RCVPSTGACECPPGFIGARCHTACPAGHFGPDCAGAAACGEGAPTDPVSGRCLCGPGRRG
EDCGHDCPPGWFGVGCLHRCNCSHGNRCDAATGNCTCGLGWTGARCDEECPAGHFGANCQ
LRCDCQNNSTCDRVTGTCRCAAGHYGRQCEHSCPPGLYGPSCQLQCDCANGAFCHPATGQ
CMCPAGYRGARCHRLCEQGTYGVGCAQVCNCGGAAACDHVTGRCLCSSGKTGPRCDLDCR
ENFYGPDCAETCECENGAQCDPRNGRCSCRHSWIGPACQEGAVGLAQLQHTHTHTRLSAA
SF
Download sequence
Identical sequences H3C853
ENSTNIP00000004425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]