SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004441 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004441
Domain Number 1 Region: 44-104
Classification Level Classification E-value
Superfamily GLA-domain 1e-22
Family GLA-domain 0.00068
Further Details:      
 
Domain Number 2 Region: 96-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000894
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004441
Domain Number - Region: 152-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00175
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004441   Gene: ENSTNIG00000002027   Transcript: ENSTNIT00000004581
Sequence length 211
Comment pep:novel chromosome:TETRAODON8:Un_random:92272161:92273391:1 gene:ENSTNIG00000002027 transcript:ENSTNIT00000004581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPTAAVRLLALLFLSTLARCTVFLDPSSAARVLRPSTRGRRANAFALEELLPGDLEREC
YEETCSQEEAAEIFHTKEKTLEFWFRYVDRNPCRTDPCQNGGMCTVERGAFMCLCPPRYS
GKTCESGDQVLVCARPLPEAQLSWVSALCSSEVTECRHRNGGCWQYCADVPGGVECGAPT
GTSWNPTDAAAARQVSPPDETRSNVFIRPLK
Download sequence
Identical sequences H3C869
ENSTNIP00000004441 99883.ENSTNIP00000004441 ENSTNIP00000004441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]