SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004465 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004465
Domain Number 1 Region: 543-675
Classification Level Classification E-value
Superfamily PX domain 7.59e-22
Family PX domain 0.0023
Further Details:      
 
Domain Number 2 Region: 326-469
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.47e-21
Family Regulator of G-protein signaling, RGS 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004465   Gene: ENSTNIG00000017300   Transcript: ENSTNIT00000004606
Sequence length 741
Comment pep:known_by_projection chromosome:TETRAODON8:10:6994588:7002304:-1 gene:ENSTNIG00000017300 transcript:ENSTNIT00000004606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWIRVCVHRIRRRMRLDRFRELRQYPVFCFLLLLLLLSTVLLNRLYIHIIMVFWSFLAG
VATFYCSLGPESLLPNIFGPIKPKTKSFQQELFPLGHSCAVCGKIKCKRHRPTLLLENYQ
PWLDLKIPSKVDASLSEILELVLENFVYPWYRDVTDDEAFVDELRVTLRFFAAVLVRRTQ
KVDVASLITQKLLKVSMKHIEIISKARQKVRNVEFLQQAALEEYGPDLHMALRSRRDELL
YLRKLTEMLFPYILPPKAADCRSLTLLIREVLAGSVFLPSLDYLADPDTVNHLLLIFMDN
SPPEEATEPISPLVPFLQKYSDARSKKPSVLKLELREIREQQDLLFRFMNFLKQEGAVHV
LQFCLAVEEFNDRILCPELSDSQKMMLHEELRKIYETYCLDESIDKIRFDPFIVEDNLPV
AEGPYPQVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPARSSRMS
RNTSKRGETFGISRIGSKIKGVFKSTTMEGAMLPSSGLVEGEDDLVEEAMMVVEDDSPME
AASSPTTPRNLSAWNITIPYIDFYDDDVKRERIPVFCIDVERNDRKAVGHETERWSVYRR
YLEFYVLESKLTEFHGSFPDAQLPSKRIIGPKNYEFLRSKREEFQEYLQKLLQHPELSNS
QLLADFLSPHSTESQFLDKMLPDVNLGKIIKSVPSKLIKEKGQHLEPFIQSFFNSCESPK
PKPSRPELTILSPTSENDKKV
Download sequence
Identical sequences H3C893
ENSTNIP00000004465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]