SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004467 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004467
Domain Number 1 Region: 5-483
Classification Level Classification E-value
Superfamily Sema domain 3.14e-179
Family Sema domain 0.0000000000353
Further Details:      
 
Domain Number 2 Region: 545-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000398
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 3 Region: 479-530
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000698
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004467   Gene: ENSTNIG00000014748   Transcript: ENSTNIT00000004608
Sequence length 723
Comment pep:known_by_projection chromosome:TETRAODON8:11:5477614:5491839:-1 gene:ENSTNIG00000014748 transcript:ENSTNIT00000004608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELKSTGTAHHFSFLLNSTDYRILRMDEDHDRMYVGSKDYILSLDLNDINKEPLIIHWPVA
SQRKTECVLSGKDTNGECGNFIRLIEPWNRTHLYVCGTGAYNPVCTYVDRGRRSQEYIFR
LEPGKVDSGKGKCPFDPKLNSVSALINGELYAGVYIDFMGTDSAIFRTLGQKTAMRTDQY
NSRWLNDPTFVHAHLIPDSAEKNDDKLYFFFREKASEMGQSPMTQSRIGRICLNDDGGHC
CLVNKWSTFLKARLICSVPGTDGIETHFDELRDVYIQPTQDTKNPVIYGVFSVSGAVFKG
SAVCVYSMADIRMVFNGPFAHKEGPNYQWVAYTGKIPYPRPGTCPGGTFTPNMKSTKDYP
DEVINFMRNHPTMYNVVYPVHKRPLVVRTNVDYEFTTIAVDQVTAADGSYEVLFLGTDRG
TVQKVIVLPRDDLQTEELVLEEVEVFKVPTPITTMKISSKRQQLYVGSVLGVTHLALHRC
DVYGEACADCCLARDPYCAWDGKSCSRYSNSQKRRSRRQDVKYGNPIRQCRGYNSNTNKN
TLETVQYGVEGSTTFLECQARSPHMSLKWHLQKENSDRRKEIRSEGRILKTEHGLLIRSL
QPSDGGIYQCTSTEKNFKHTLVKLQLVVLSSRTVNNVLVETGSPALPPLQSSPWTPNAGQ
YKDLLTILSQPEMGLINQYCQDYWQLGEGGLGDGKAKSLKELKEQKKPRNRRHHDEETTP
AET
Download sequence
Identical sequences H3C895
ENSTNIP00000004467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]