SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004483 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004483
Domain Number 1 Region: 523-697,899-1038
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.1e-53
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 3557-3747
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-26
Family APC10-like 0.015
Further Details:      
 
Domain Number 3 Region: 2240-2284,2365-2407
Classification Level Classification E-value
Superfamily E set domains 0.000000012
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 4 Region: 4298-4373
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000198
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004483
Domain Number - Region: 3215-3304,3511-3583,3876-3941
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family HEAT repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004483   Gene: ENSTNIG00000014997   Transcript: ENSTNIT00000004624
Sequence length 4550
Comment pep:known_by_projection chromosome:TETRAODON8:2:10521219:10561152:-1 gene:ENSTNIG00000014997 transcript:ENSTNIT00000004624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCAAAAAAAAGGGGILPSSSPLMGLGVRVFSGAGADLCTTGTGMGSCPTPGAQSDCRTR
YQLLLSGRALADKYRRIYTSAINDKEQGINQGRGKKALSKKKLKRRQKVKSKVKSRTKAE
CLDGALFVPDIKLHSNPSAFNVYCNVRHCVLDWQQREASLALASRSSVQSGDSDSEEEEE
FREPAVKLPKIIGIGLCGVFELIKETRFSHPSLCLRSLQALLDMLQGQQPEGFQTEPPDV
LESLFQLLLETTVRSTGPNDPTGQAITALSCACLFSLVVAWGDTGKILQAVSAILTNNGS
HACQTIQVPTILNALQRSVQAVLVGKIQIQDWFGNGIKRAALMNKWVLKEVAIDDDEHCL
LQTDGSFLYLLCNDGLYKVGSGYSGTVRGHVYNSTSRVRNRTEKRSWLGFAQGYLLYRDT
SNHTMTAIKINPETLDPEGTVIMPGQHGQDGQNIIFTDGEYINQIAACKDDGFVVRIYTM
SSDPALQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEEAALIGAGREFALMKTAS
GKIYYTLNYHILFIIFGGPSAWKLVEFPFTKSPNITHFXSVFFTGSASKGEDGESTKSRR
QPKPYPKKMIKLETKTAVYTACNNGSSSIVTKDGELYMFGKDAIYSDSTCQVTDLKGHCV
TQVAMGKAHTCVLTKNGEVWTFGVNNKGQCGRDTGSMSQAGKAFGVESMATAMDEDLEDE
LEEKEEKSMMCQPGMHKWKLDQCMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGES
GCSVCGCCKACARELDGQEARQRGIFDAVKEMIPLDLLLGVNIEEHIQIRQEEKRQRINR
RHRLEEGRGPLVFPGPIFMNQREQALARIRPLQALRHKRDKQKDGSSERGEKDASKITTY
PPGAVRFDCELRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPTLVQAL
PGPSVQVTAGSNHTAVLLIDGQVFTFGSFSKGQLGRPILDMPYWNAKPSPMPNIGAKYGR
KATWIGASGDQTFLRIDEALINSHVLATSEIFASKHIIGLVPSFVSESPPFKCLLINKMD
GSCRTFNDSEQEDLQGFGLCLDPVYDVIWRFLPATREMLCYNAVIADARMSSATDLQARC
SILSPELALPSGSHATTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMKVFSKE
DYSVVNRFESHGGGWGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFELGPDG
GDHETDGDLLAETDVLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDCGSHGQ
ATITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLYRLPSNDGNASKGKQQTSEPVHILKR
SFARTVSVVKECFDSLLSILHWSWTTLVLGVEELRGLKGFQYTATLLDLERLRFVGTCCL
RLLRVYICEIFPIAASTKAVVEESSKLAECVGKTRSLLKKILSEGMDNCLTRLDNDPQGY
LSQPLTLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIAEANFRTSSSRL
LAAVMSALCNTSVKLTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEKLSH
TEENLMGMTSFREVLEKMLVIVVLPVRKSLRKEVELFSPHLVSNTCGLLASIVSELTASA
LGSEVDGLNSLHSVKTSPNRFTKTSQGRSWNTGNGSPDAICLTVDKPGVVLVGVCVYGGG
GIHEYELEVLADDPVQTEHPGDSAHSHRWTSLELVKGTYSTDDSPSDISEIRLDKAVPLK
EGVKYAVRLRNYGSRTANGDGGMTTIQCSDGVSFTFSTCSLSSNGTNQTRGQIPQILYYR
SEYDGDLQSQLVSKANEEDKNCSRALSVVNAVVRAAKDLLHRAFAVDVDDIPELLSSSSL
FSMLLPLILAYIGPVAASVPKAAVEVFVLVQDLLPAVSALNQKYAPPTFNPNQSTDSTTG
NQPEQGLSACTTSNHYSVIESDHPYKQASVTQYRVSFPDCVRWTTIEFDPQCGTAQPEDV
LRLLIPNRTLHLSSLGGKPLIHDTINTWTELRKFSGSTGWPTSVLVLPGNELLFSLETAS
DYVKDEKACFYGFKCVAVGYEFNPGPDEGLIMLEKELAYLGSVCAAALMKKDLALPIGNE
LEEDLEILEEASLQVCKSHSGILGKGLALSHSPTILEALEGNLPLHLQTNEHSFLEDFIT
CVQNSSGGRLARWLQPDSYADPQKTSLILNKDDIRCGWPATVVVQTKDQYGDVVHVPNMK
VEVKAVPVSQKKSVQPDNIKKLQRLPGNSSPSSSGPDLTFGGLPTPKLEATYEPVIVKEA
RYIAITMMKAYENYSFEELRFASPTPKRPSENMLIRANTDGTYSANWTPGAVGLYTIHVT
IDGIEIDAGLEVEVKDPPKGMIPPGTQMVKPKAEPQPSKVRKFVSKDSAGLRVRSHPSLQ
SDQIGVVHVNGTITFIDEIHNDDGVWLRLNDETVKKYVPSMNGYTEAWCLSFNQHLGRTL
LVPADVVNSEGSWVQLDKNSVVEFCESDEGEAWSLARDRGGNQYLRHDEEQVLVEHGAQT
PPPSPFSVPAFNRPATSNGAQGFDYGLSNNKGDRGNTTSGTRPMSPASKHRQENRLPKQE
SRGIRSSDQTRVKTGDGGLSAGEALILRSDTAKLRSDSHSRSHSPNHNTLQALKADGRTP
GLRTDSPNSSSRSSSPKQKMVSSSGRSSPSSTSSQNPPSTHYDKNLQAKISPSSKALLDP
PRERSKSDSYTLDPDTLRKKKIPLTEPLRGRSTSPKPKLSPKDPNKGAITNVENRVPSPH
VTQENLHSEVVEVCTSSALLSNEDCNDENVEVHNAEDGSCKVHFSIGKAPVKEEVESRSS
PKVSRKTSSRHTRPKKDKSGPLFKGESTSRVTEPVKQAMSPSVAECARAVFAAFLWHEGI
VHDAMACSSFLKFNPDLTKEHAPIRSSLGGQGSEEKESKLKNRHSLEISSALNMFNIAPH
GPDISKMGSINKNKVLSMLKEPPLPEKCEDGKGEAISYETTSHSSMRAKSILPLTLQHLV
AFWEDISMATIKAATQNMIFPSPGSSAIPEVRPRGNLFGEMAQLAMGGPEKDTICELCGE
SHPYPVTYHMRQAHPGCGRYAGGQGYNSIGHFCGGWAGNCGDGGIGGSTWYLVCDRCREK
YLREKQTAAREKVKQSRKKPLQVKTPRALPTMEAHQVIRANALFLLSLSSAAEPSMLCHH
PPRPLHSQLLPSLKEGVSDEPPNKMGCLYLQTLARQHTENFGAYPDDNLFQDEMRYLRST
SVPAPYISVTPDACPNVFEEPESNMKSMPPSLETSPITDSDTAKRTVFQRSYSVVASEYD
KQHSPSPARVKAVPRRRVHSGDAEVGSSLLRHPSPELSRLISAHGSLSKGERNFQWPVLA
FVIQHHDLEGLEVAMRHALRKSACRVFAMEAFNWLLCNVIQTTCLHDILWHFVASLTPSP
FEPEDEEDEENKGNKEIVEQERDLGVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMM
SLPSGSSLQQMALRCWSLKFKPSDHQFLHQSNVFHHINNILSKSDDGDSEESFNISVQSG
YEAMSQDLCMVTCLKDLTSVVDIRTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIN
CVKGINASNVSVHVDNSRDLGNKVTSVAFLCGKAIEDLCRIKQVDLDSRHMGWVTSELPG
GDYHVIKVELKGPENTLRVRQVKVLGWKDGESIKILGQISASMAQQKNCEAETLRVFRLI
TSQVFGKLICGDAEPTPEQEEKNLLSSPEGEDKVPSDADLKEHMVGIIFSRSKLTNLQKQ
VCAHIVQAIRMEATRVREEWEHAISSKENANSQPSDDDASSDAYCFELLSMVLALSGSNV
GRQYLAQQLTLMQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPVRLASIIGVKALPPADI
SDIIHSTEKGDWNKLCILDMFLGCIAKALTVQLKAKGTTISGTAGMAAGKGVTTVTLPMI
FNSSYIRRGESHWWMKGSTPPQIAEIIIKLVKDMAAGHLSEAWSRVTKNAIAETIIALTK
MEEEHRSPVRCIATTRLWLALASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHDDGE
TAAIILCNMCGNLCTDCDRFLHLHRRTRSHQRQVFKEEEEAIKVDLHEGCGRTKLFWLMA
LADSKTMKAMVEFREHTGKPTSSSSDACRFCGTRNGTELSAVGSVCSDPDCQEYAKQACS
KTHPCGHPCGGVKNEETCLPCLHGCDKSTGCLKQDADDMCMICFTEALSAAPAVQLDCTH
VFHLQCTRRVLENRWLGPRITFGFMLCPICKNKINHSVIKDLLDPIKELYEDVRRKALMR
LEYEGLHKSEAITTPGARFHNDPAGFAMNRYAYYVCYKCKKAYFGGEARCDAEAGQGDDY
DPSELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMT
SVPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF
Download sequence
Identical sequences H3C8B1
ENSTNIP00000004483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]