SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004526 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004526
Domain Number 1 Region: 21-165
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.32e-31
Family NAD kinase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004526   Gene: ENSTNIG00000002092   Transcript: ENSTNIT00000004667
Sequence length 194
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:47681507:47682497:-1 gene:ENSTNIG00000002092 transcript:ENSTNIT00000004667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRHIQDPASQRLTWNTPPKSVLVIKKIQDASLLEPFKELCIFLAKVKNMIVYVEKKVLE
DPAISSNENFGAITKGFCTFREDLDNISNLVDFIICLGGDGTLLYASSLFQESVPPVMAF
HLGSLGFLTPFKFDTYQSQVTQVIEGNAAIVLRSRLKVRVLKENREKKARVDELGAIWTN
GDVEGSRRVAQYQV
Download sequence
Identical sequences Q4TFW9
ENSTNIP00000004526 ENSTNIP00000004526 99883.ENSTNIP00000004526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]