SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004527 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004527
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.00000000000000154
Family NAD kinase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004527   Gene: ENSTNIG00000002093   Transcript: ENSTNIT00000004668
Sequence length 87
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:47684983:47685676:-1 gene:ENSTNIG00000002093 transcript:ENSTNIT00000004668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRPIVVPAGVELKIMLSCDARNTAWVSFDGRKRQEICHGDSITITTSCFPVPSICFRDPV
NDWFESLAQCLHWNVRKKQNYLSSEDE
Download sequence
Identical sequences Q4TFW8
ENSTNIP00000004527 ENSTNIP00000004527 99883.ENSTNIP00000004527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]