SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004556 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004556
Domain Number 1 Region: 55-275
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.85e-53
Family Ankyrin repeat 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004556   Gene: ENSTNIG00000002121   Transcript: ENSTNIT00000004697
Sequence length 611
Comment pep:known_by_projection chromosome:TETRAODON8:5:12166792:12170094:-1 gene:ENSTNIG00000002121 transcript:ENSTNIT00000004697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQGHDCHHGHGGHSHGHGPRPAHAFMGNFPGKSADQAMNLSQQPKKRSHMDDSSSWDIVK
ASQFGILERCKELVEAGYDVRQPDKENVTLLHWAAINNRSELVKYYISKGAIVDQLGGDL
SSTPLHWAIRQGHLSMVIQLLRYGADPSIADGEGYRALHLAILFQHMAIAAYLMAKGQDV
DEQDANGQTPVMLAALKIIGPEPTKFLVKNNASLSAVDKVNRNTPLHCAVLAGNVDAAHI
LLEGGASVDAENLSGHTPIDLAHQVHSPLLVHMLNHVKQERIRSNSRCLRVINRYRPFLQ
FLLCVALLGSVGAILDMDSESWLLKGFLLACVIGGTNVASRNFASPAFESLLPCASLMAS
VFWMLVTWFLWFLPNILLSTAEVLFMLNATALLYYYLRACRTDPGFVRSTEEEKKKNVLV
LAEAGCFNPRVFCTSCMIKKPMRTQHCYMCDACVAKQDHHSIWINGCIGARNHHYYVLFL
LSLTLMGSWMFYGCFVHWVTHCPLRYAEQGLWGAASALVDCSPWLLCVFFLAFYHTCWSS
SILLVQLYQIAVLGLTSAERTTLALQQRRLQQPVSLRQNPYNLGVLRNLVSFFQLRCCGL
FKPAVIDWTQQ
Download sequence
Identical sequences H3C8I4
ENSTNIP00000004556 99883.ENSTNIP00000004556 ENSTNIP00000004556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]