SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004566 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004566
Domain Number 1 Region: 113-147
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000445
Family HIT zinc finger 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004566   Gene: ENSTNIG00000002131   Transcript: ENSTNIT00000004707
Sequence length 154
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:44348118:44349159:-1 gene:ENSTNIG00000002131 transcript:ENSTNIT00000004707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAARVEAGQHRVLDEATRQRRLSRQLEALEKDNFHLQDDPLSSLPPPGPTARLPAFSET
EEPEKKKRKTRGDHFKQRFRKNFTALLEEEQNLSERPEPNYLSAVAPPSVVPPRHFCCVC
GFPSHYTCPTCGGRYCSSRCLCTHRETRCLKWTL
Download sequence
Identical sequences H3C8J4
ENSTNIP00000004566 99883.ENSTNIP00000004566 ENSTNIP00000004566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]