SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004602 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000004602
Domain Number - Region: 209-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000686
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004602   Gene: ENSTNIG00000002164   Transcript: ENSTNIT00000004745
Sequence length 271
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:48782021:48783553:1 gene:ENSTNIG00000002164 transcript:ENSTNIT00000004745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDSKFLRVHQDLPVSTFRMRDSEDLVLSQPFLQFLHALPLEYNYALYREIFQRFGTHYYH
SGVLGGRYDLLYQYSREQLQSSGTTEEHLSGCLAQETSWTVILYSQHSSVLRCSDNRMTE
KFQGSGRAAEKSYSLVRGGRAREAAALAWERQGPTPDRTSYRNWAKSVLDNPAVVESQVS
PLIDLVKRIPCAVTKRRHLRRALLQYLDEFDSCRCAPCPNNARAVLSGTECTCVCQTGTF
GSHCEQRAPDYTSESVDGSWSCWGPWSSCGS
Download sequence
Identical sequences H3C8N0
99883.ENSTNIP00000004602 ENSTNIP00000004602 ENSTNIP00000004602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]