SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004615 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004615
Domain Number 1 Region: 76-182
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0035
Further Details:      
 
Domain Number 2 Region: 25-88
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000186
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004615   Gene: ENSTNIG00000002175   Transcript: ENSTNIT00000004758
Sequence length 192
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:48923123:48924208:1 gene:ENSTNIG00000002175 transcript:ENSTNIT00000004758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEICGFRVHNGPSGSGTVQFEAVVLDRSTGEGLVRSKEPLDCETQREHSFTIQAYDCGEG
PDGANSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDRIVRVEALDADCSPQY
SQICFYDIITPNVPFAVDNDGNIKNTEPLDSKHQRVHTFWVTAFDCGKNRAAADAQVVIT
VKPSCKPGWMGR
Download sequence
Identical sequences Q4TFC1
ENSTNIP00000004615 99883.ENSTNIP00000004615 ENSTNIP00000004615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]