SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004687 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004687
Domain Number 1 Region: 2264-2445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-33
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 2845-3006
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-32
Family Laminin G-like module 0.0000465
Further Details:      
 
Domain Number 3 Region: 2085-2260
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.53e-26
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 2679-2822
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-25
Family Laminin G-like module 0.0009
Further Details:      
 
Domain Number 5 Region: 2449-2640
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.34e-24
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 6 Region: 817-870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000121
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 7 Region: 870-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 767-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000197
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 9 Region: 709-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000347
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 10 Region: 251-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 11 Region: 378-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 12 Region: 1375-1426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1432-1483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000787
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 14 Region: 1012-1060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 15 Region: 308-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 16 Region: 439-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004687
Domain Number - Region: 1481-1522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000254
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 966-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family Laminin-type module 0.012
Further Details:      
 
Domain Number - Region: 919-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 674-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 1961-2069
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00759
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number - Region: 59-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0238
Family APC10-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004687   Gene: ENSTNIG00000013519   Transcript: ENSTNIT00000004830
Sequence length 3033
Comment pep:known_by_projection chromosome:TETRAODON8:4:4143012:4193512:-1 gene:ENSTNIG00000013519 transcript:ENSTNIT00000004830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAILNLASNAVIDSNATCGDPGPEVYCKLVEHVPGRPVKNPHCARCDANSVLFRERH
PITNAIDGTNRWWQSPSIKNGRQFHWVTVTLDLKQVFQVAYVIIKAANSPRPGGNWILER
SLDGLTFDPWQYYAISDSECLSRYNVTPRLGPPTYKKDTEVICTSYYSRLNPLEHGEIHT
SLINGRPGADDLTSELLNFTSARYIRLRLQRIRTLNADLMTLSTRDPRDIDPIVTRRYYY
SIKDISVGGMCICYGHAQSCPLDLVTKKLQCVCEHNTCGESCNECCPGYHQQPWQPGTVS
EGNTCEKCNCHNKATDCFYNQTVAELSLSLDLHGLRRGGGVCVSCQQNTAGVNCESCVDG
YYRPAEVSPYSDFPCVACSCDPRGSESPVCSRGDTQPGQCVCKQGFTGRQCDTCAFGYRD
FPQCVRCECHSAGSTNADPCTPCTCKVNVMGANCDLCKPGFYNLQASNPLGCTDCFCFGV
SDVCESSAWSTAQVLHVDAWLLPHPAPPLTPVVHDNDLHTPGNTSSGHSYQEILLWEAPD
SFLGNKLGSYGGFLNYSLVYDVPLDNQDHSLPAHSDVIITGNGRALHSSPHFLFLSPLAE
SWVAMAIADRQLRDVETGDPVSRDELLLALANVTALTVRVGLNTSADGPIRLRLVSLDSA
DPSSASTQQAVAVETCECPWGYSGTSCEVCLSGFYRVGGVLFGGNCMQCECNDHATECDS
AGVCLVSCAHNTSGPHCEECLPGFYGNATEGTADDCQPCPCPLTNPSNSFSPTCVLEASG
QVSCDRCQEGYTGTTCERCASGFYGNPQVVGGTCVRCDCHGNVNVSEAGHCDVVTGECLR
CLFNTGGPHCEVCQPGYYGDAVRAKNCQECGCDVVGAVSSVCDVTTGQCLCRENVTGRAC
ERCQSGFFGLRREQGCQGCGCNQSGSLSESCDEEGRCRCMTGVGGDKCDRCGHGYYGADI
SSCRACTCVHTGGNCDPQTGECTCPANTEGPTCGRCKAGYWGHNPTTGCEPCSCSVEGSS
ALECDLTNGQCQCREGFGGKSCDHCATGYHGYPACLPCGCDLAGTAQDMCHNAEYLRVCE
HAVHQCVCFQVGVSGRRCEECVSGRFALSADHPDGCSPCFCSGVSGDCEEQGGLLRVPLT
LDPSPAPLSVVSQSNLRGVVSGVYQQGGDMLLDTRQLNTSGLAGPLYWRLPPQFEGPQLL
SYGGSLSYTITFYAEDGSGLSNQEPQVMIRGGTLKKMVIYTDMVAPSNGITTKHEIRMTE
HKWKYFNSVLETSVSHPDFMSVLGNIEYLIIKASYGSRLQQSRISNITMETAVEAAEGSE
VIGDLARSIESCICPTGYTGLSCQQGCAAGFFHQPLSELSSQRQRFLSVRPCVPCRCSNH
SERCDVESGECQDCQHHTSGESCQQCAPGYHGNVSGSISDCSLCACPLKDNSFSATCVSE
GLLGDFRCTACQSGYQGRYCERCSTGFYGNPSVPGGVCLPCDCSGWGSRQPVCNNLSGKC
DCKAGVKGRSCDQCEDRHILQEGECVSCDDSCTGVLLNELEDVDHHLRTVNISSLAVASY
LQLAQLEKQSRQLQTDFLSSRAVVDDRLRPLSAALDRNSEMLRHLREHLSNAAQQNQQTH
KLQGGLHTLAQQYQVRHTHAHTQTVQSEPSLTEESRTHLDMSAALLEECEQTREESVRIV
YNHNLMSGTPQENTTIEANILKKNLSRFNKRVQLNQRSLEATKTAAAQRLNGHSSEMASD
RDLLQSARSRAQQPQFPLSLNPVNSLRRYTQQRLAFQLEEILFVSLVLQSQGWARMAKTH
SKQVNRTHTQTHSHLDQWRPLLRKQVDGLVVGLKTTDALEKVYQSEKHSQQLQEEGHTLH
SLLSVCNVSLNGSQTSEVTDQVHRSQQVAFMADASAWFVFNTTVQSEPSLTEESRTHLDM
SSALREECEQTREECAGVFFFFYSLRNFSLLFRHPIRELQSLSNVSLSELQPAGLQPAAA
DPRLQGALQRLHSLEEQLQGSSSAVENTSNTARETNQLTAHTLATANQAQQKLGEVERRT
ERLMEQIKPLSVLGETLNRNLSEIRELIKQARRQAASIKVAVQADGKCVRSYRPESESRN
FNTLSLVLKTSSPDNLLFFQGSNTTRDFLALETHAGRVSLLWDLGSGSTRLEFPGLDIAN
NRWTRINATRFGARASLWVHPLESDAEPLPAVMASSPGPARILDVDRNSLLYIGGLGAHV
QSPAALRSSTFRGCLGEASLNERNVGLWNYNSREGECGGCFSSPQAEETSFHFDGSGFSL
VQKSLRATSTSIVLLFKTLSPGGLLLYLASNNTRDFLSIELVEGQVRLTFDLGSGALVLT
SSRKYNTGTWYKITLQRTKRKGYLSIMAADQPSEKEVLEAESPGTASDLNRSDFDPIYIG
GLPASRPIRRQVVSRSYVGCIKNVEIARSNFDLLRDAFGVRKGCVLEAFRSVSLLTGGYV
QIAPQPLGQEAELLFSFSTNNQSGILLAAFSPDHSQRRVGRGVYFLSIHLASGAVEAVIG
EVGGAPQTVTVVKTNGGYFSDGVRHSVIVTINRKTLSIQVDEDNVKSIALLPGRFSHLSP
ASFFIGGVPFGAESRLPARLQELSLSFRGCIQHLVLGGVLIDLSGALRYEGAELDSCLLK
EKDAEPTVDPAHLPVVPPTQLTPGPLTCVSEAAPSFLPSAAQFGLSKHSHMTFMINPSAL
RKSLSVRLSVRSRVPDGMILLLSDAKQMDFVVLKLTGGKLTLSADLGRGPASITSPVTVS
DSQWHTVSAEVSRRSLSLAADASKPNSVSIKGNQLDVEKRLYLGGLPHGHATRRINVGCL
SSRSSQPELGPGGQRSRSVQTTSRHNVTSCFTNDQAGSYFNGKLRRLQVRDGYKVGSDVS
VSLDFRTSQSEGVFLGISSAKIDAIGLEMINGQVVFNVNNGAGRVTVASAGQLLCDGRWH
HLLARKTKHSLSLKVDGRSYTTLNPYPQSTSAETKDPVYLGGYPVGVKQNCLSIASRFRG
CLKNAQLVKSHLNDALELGSAHSYSGITPHSCP
Download sequence
Identical sequences H3C8W5
ENSTNIP00000004687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]