SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004691 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004691
Domain Number 1 Region: 13-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004691
Domain Number - Region: 381-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000137
Family Laminin-type module 0.0018
Further Details:      
 
Domain Number - Region: 798-899,954-987
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00251
Family BAR domain 0.073
Further Details:      
 
Domain Number - Region: 495-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family Laminin-type module 0.053
Further Details:      
 
Domain Number - Region: 715-815
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0186
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 300-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004691   Gene: ENSTNIG00000003625   Transcript: ENSTNIT00000004834
Sequence length 1106
Comment pep:novel chromosome:TETRAODON8:15_random:82118:88820:1 gene:ENSTNIG00000003625 transcript:ENSTNIT00000004834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYQQAAPLGCSPCGCHPVGSVSSTCDSRGRCSCKDGVMGQKCDRCSDGPIGPNGCTQSSL
DPAQPLATAFYSLTLVQLQPSPSCFVGFLELKVKAASAPLPCFCHGHSSRCSAGSGYSVH
PITSTFTDGPEGWGTAGVRDTGPTGVLFRWSPKHQDLEVISTSSLPAYLKAPGPYLGNQL
LSYGQNLSFSLRMDHSVRQPSYNDVILEGGGLQVAASLGGLLSAAPCRQKMNYTFRLDEQ
PSSGWRPQLSSQQFQTLLQNLTSLRIRATFGPDLVFSGRGYLDNVQMVSARRGDGSPAPW
VRTCSCPLGHEGDFCERCSARFKRTNPAEGPFSSCEPCGCRGGGCDPQTGDCYSADETAA
QLKCPPGFYRNRWDPESCLRCPCPGGVSCTLQDGSGQPQCDPCPLGTTGRRCDVCQEGFY
GDPVGNRACRGNTPPLPPFCSVGCSGSGTALARSQQPGESPAVGQRSTPPLAGTKMVQVE
AEKKGAGTTDEKAACDCDPRGSVSTRCDHLGRCQCKPGFQGVRCQSSSCPACFTSIKMKM
KEYTTKLEEMLLDVGRGHDGVESPEMEAALRNMEQLMDNVQLDMDKLTGSGPARLETRLQ
DRLSSANTTHVSNRETIQKIAEVQDDAQQRHQLYNRKVDEVQKLLEEMKQNLERAENELR
SADVPSGDAPQASGFSALLQTALTLADLHQREADVVHQSSSAALNGSMKSLALVQTLMSK
ENKVKDVVGGLRSRHDQTSAQVKDLENQAQHLSSEAREESAAANSMLTDIAKLEQELPSD
LKDDVDTMTSMLSDLAEAATRSSEDLDSLQQGVKQNKAAMENLLKEGRASGQTLEKLLGR
VEAAREVTNAALQGFQGSSEDLNAALTSLKGFNQQINNYRAEADGAVRRLDAINATVQQA
ASSNAETQAVLRDMSEDFRRGLANANTLENLLSSAEGAFRSLPAHSHLLAEGTELKEDSE
ALKIRVDRAAEDLQTEMDAATRLEDDSGQAAVAAAGALDHSRRSRAAVEQTLQQINGLLA
QMNQTGLVDQGRLQQMEHLLASAEREVEQRLRPWLREAELQEDAHKRHLSAVTADMDAVL
ADIDNLKDILASVPEGCFNTLPIEKP
Download sequence
Identical sequences H3C8W9
ENSTNIP00000004691 ENSTNIP00000004691 99883.ENSTNIP00000004691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]