SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004703 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004703
Domain Number 1 Region: 119-184
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-20
Family Second domain of FERM 0.0000204
Further Details:      
 
Domain Number 2 Region: 4-59
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000011
Family First domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004703   Gene: ENSTNIG00000002244   Transcript: ENSTNIT00000004847
Sequence length 185
Comment pep:novel chromosome:TETRAODON8:Un_random:49603132:49603953:-1 gene:ENSTNIG00000002244 transcript:ENSTNIT00000004847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRDMGEE
KKEETTGTLRKDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEETEMLLLRRK
FFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHN
SGFLE
Download sequence
Identical sequences H3C8Y1
ENSTNIP00000004703 99883.ENSTNIP00000004703 ENSTNIP00000004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]