SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004716 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004716
Domain Number 1 Region: 153-345
Classification Level Classification E-value
Superfamily vWA-like 3.4e-57
Family Integrin A (or I) domain 0.00059
Further Details:      
 
Domain Number 2 Region: 5-138
Classification Level Classification E-value
Superfamily vWA-like 4.62e-32
Family Integrin A (or I) domain 0.0024
Further Details:      
 
Domain Number 3 Region: 929-1122
Classification Level Classification E-value
Superfamily vWA-like 7.71e-30
Family Integrin A (or I) domain 0.0055
Further Details:      
 
Domain Number 4 Region: 1142-1305
Classification Level Classification E-value
Superfamily vWA-like 1.69e-23
Family Integrin A (or I) domain 0.0023
Further Details:      
 
Domain Number 5 Region: 363-566
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000924
Family Integrin A (or I) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004716   Gene: ENSTNIG00000002726   Transcript: ENSTNIT00000004860
Sequence length 1305
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54215480:54227329:1 gene:ENSTNIG00000002726 transcript:ENSTNIT00000004860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVSSDEPHQEFLLKYHIEKMNLLAAFESFPYRNGGTETGKAINFLRKQYFTKKAGSRAD
QRVPQIAVVITDGDSTDDVVVPARELRKHGVIVFAIGVGNANQGELKSIANRPSERFKFT
IDSFQALKRLTERLLETISAPSSAVWSTNSTSAPPPNCKAANIADIVFIIDESGSIGSSD
FQLVRTFLHSLVSGLEVSPNRVRVGIVVYHGEPKAEVFLNTFTDKSELLDFIRILPYHGG
GTNTGAALNFTQHQVFVREKGSRIELGVQQVAVVITDGRSQDDDDVEEAARLLRGLGVEV
FAIGIGNVHDLELLQIAGTPENVFTVKNFDKLEGIHQKVVDTICQSKPIPDPSRPNGTHL
VAGCSIDIAMGFDISRRSGAPGETLVSGHAALRNFLLEIADYVSSISGLCCTDSKPVQTN
IGYRVVRQDGSTLYDFNFEPHSSEVVKKVMTSSVATPTSFNTALLKSFQEKFRQSQGLVL
VIFSDGLDEDVIKLEEESERLRLSGRVSALLLVALEGTSLGQLQMVEFGRGFGYKVPLSI
SMPSVGSTILKQIDMVSDRECCGVMCKCSGHEGVRGLRGSPGSKGVTGQQGYPGFPGEEG
VAGERGRPGPSGPQGVQGCSGPRGLVGNRGLRGNRGENGEDGLNGVDGEQGDAGNDGSRG
ERGHAGNPGIPGIRGEAGLKGERGLRGDPGEPGTRNTVQGPKGDPGSPGLPGPTGMDGEP
GKDGANGQQGPDGRRGPPGEKGFTGKPGDAGPPGLPGASGPVGSRGNKGDTGPPGVAGLP
GPQGGPGPAGNPGASGRRGVVGPKGQPGEPGQQGVPGPQGPRGLPGQDGKDGYGPAGPGG
VKGDPGFPGYPGLVGENGLQGPKGTPGPKGNQGQPGKAGPAGESGLSGEPGYAGHRGPRG
PPGKPAMTECQLITYIKDNCACSSHHPRCPVYPTELVFGLDMSQDVKPADFQRQRAALLS
LIEDIAVSESNCPTGARVAVVGYSSYVKHLVRFQDYRRKEQLLEFVKNIPLERSGNSRRL
GGAMRFVGHNVFKRVRAGAVTRKVAVFFSNGLTQDDGDLVAAVMEYRGLGVVPAIVSLKN
APSVSRALELDDSGNAIFSVLGRDAVASLQKVKDCAICYDPCQRSQQCSFIQEKLGPQEA
NLDLALVVDGSREVQADQFAGIQQLLGSVVEQLAVSPQPRKPGDQARVAAIQQSSAQVQA
EFGLQVYQNHKLMRRHLVQNMQQQAGSSALGHTLDFALNQVLLKASHPRQRRVLFAVVAT
QTAQEDAAQLRYVAQKARCEGVALFVVTVGNRYNRTEVEEIASTP
Download sequence
Identical sequences H3C8Z4
ENSTNIP00000004716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]