SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004718 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000004718
Domain Number - Region: 259-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004718   Gene: ENSTNIG00000002256   Transcript: ENSTNIT00000004862
Sequence length 315
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:49766054:49767590:1 gene:ENSTNIG00000002256 transcript:ENSTNIT00000004862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVTVNDEESDESFESSWSYMQSIQSNALWGHDRRKFHKTVTESRAHRLIILKNKVELAQ
FQNTAPEYLTLAEGFWRALSSLPTTYDYAAYRQLFQTYGTHYFSEGSLGGEYQALLELTQ
HALATTSTTSREYERCWRKVKRRFLRKKVKTVCEKLTSSTAASYVTPWSPGTSMRNVPIK
VDVVGGNPGLKRFLSILDLENPEENGRKYDDWASSVKDFPQIIEQKVRPLYELVKEVECA
GLKKLHMKQALEEYLSAEHPCRCRPCHNNGRPLLLGSQCVCVCRLGTSGAACQSGAAVGE
QPGVIHGSWSCWSSW
Download sequence
Identical sequences H3C8Z6
99883.ENSTNIP00000004718 ENSTNIP00000004718 ENSTNIP00000004718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]