SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004749 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004749
Domain Number 1 Region: 97-411
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-94
Family Protein kinases, catalytic subunit 0.0000000428
Further Details:      
 
Domain Number 2 Region: 26-62
Classification Level Classification E-value
Superfamily PX domain 0.0000314
Family PX domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004749   Gene: ENSTNIG00000002279   Transcript: ENSTNIT00000004894
Sequence length 430
Comment pep:known_by_projection chromosome:TETRAODON8:21_random:39146:41943:1 gene:ENSTNIG00000002279 transcript:ENSTNIT00000004894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTMAVTEAGCDLTYCRMRGIVAVLTAFIKERKMGLNDFIQKLVSTPHICQHVEVNNFLKI
DKNQVPWLRTLSKCPDGPQTAALACAWSSRPLIKPYDFDYLKIIGKGSFGKVLLARHKET
TKYYAVKVLQKKIIIKKKEQKHIMAERSVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVN
GGELFYHLQRERIFLEPRARFYAAEIASALGYLHSLHIVYRDLKPENILLDSQGHIVLTD
FGLCKEGLEANGTTTTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLYEMLYGLPPFYSR
NTAEMYNNILHKSPVLKPNVSNAGRELLEGLLQKDRARRLGVKDDFLELKFHSFFSPINW
EDLMAKRITPPFVPSVSGPTDLRHFDPEFTHLPVTSSLCTETLTVTSSVREAAGAFPGFS
YGPPAEHAFM
Download sequence
Identical sequences H3C927
ENSTNIP00000004749 ENSTNIP00000004749 99883.ENSTNIP00000004749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]