SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004821 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004821
Domain Number 1 Region: 42-302
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.69e-54
Family Ankyrin repeat 0.0000381
Further Details:      
 
Domain Number 2 Region: 893-1055
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-43
Family Phosphotyrosine-binding domain (PTB) 0.0029
Further Details:      
 
Domain Number 3 Region: 682-750
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000923
Family SAM (sterile alpha motif) domain 0.0072
Further Details:      
 
Domain Number 4 Region: 758-816
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000199
Family SAM (sterile alpha motif) domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004821   Gene: ENSTNIG00000012580   Transcript: ENSTNIT00000004967
Sequence length 1162
Comment pep:known_by_projection chromosome:TETRAODON8:9:7808487:7840818:-1 gene:ENSTNIG00000012580 transcript:ENSTNIT00000004967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEQELLEAARTGNLAAVEKLLSGKRQTAAIGSGFSGTGGSGISSGHGASSHPLSSLLS
IWRGPNVNCVDSTGYTPLHHAALNGHSEVVEALLRNEALTNMADNKGCYPLHLAAWKGDE
HIVKLLIHQGPSHPKLNEQSSVDQKEFKRCGPFDPYINAKNNANETPLHCAAQYGHTGVV
RILLEELTDPTMRNNKFETPLDLAALYGRLEVVKLLLTAHPNLLSCNTKKHTPLHLASRN
GHLPVVEVLLDAGMDINYETEKGSALHEAALFGKTDVVQKLLSAGVDVNMVDQKGLTALD
VVKEMPSQKSREIAALILGHMTGKPPEMDLPPPPVPPLPGESQAAQDSASLLGDLDKMSE
LILKLAPGPEDESPYEALCDATSCHSLDSLTSGKSSDRDSGRPDSEAGKRAMVVREPHDT
EPAHSPPAAPAHEEEVRTKLAETCYTNSRADERRELVEEEEDHTYELLLTAQTKVPASTP
DSHSSKTKGGGDNSQPSQEQGAGVPEQFTGLLHGSSPVFDCREDLFRLPGVPVSSQKQTE
AKTLTKVKEEVTAVPPAPSRPNMAAILTDCDPKAIYATVHKEPKDSGSGAAPAVRTRPGD
LKLARSLSKSDSDLLVSPPVEEEGGLGNRSESVSNCSSGKKRLEKSPSFTSEWDEIEKIM
TLIGAGIDFSRDQQYATPGAAGRLLEQPVGDWLEHVGLPQYESKLLLNGFDDLHYMGSNV
MEDQDLKEIGIADASHRKKILHAARSLPKVKALGCDGSSSLSSWLENLGLHEYLHNFLAS
GYRSLECVKNLWELEIVNVLKISLLGHRKRIIASLAERPYEEPPVKPPRLSQIRCHDQPA
SQSSSPLSQMESSTGRSLDPLLPIGESGRKKVPDTEFELSQTPQSDRQRSYEDKPREPRL
TLRPPSLAAPYALVQNWHHQPEKLIFESCAYEASYLGSMLIKDLRGTESTQDACAKMRRS
TEQMRKVPTIVLSITYKGVKFIDAANKNIIAEHEIRNISCAAQDPEDLCTFAYITKDLQT
SHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQRTKQHQNLPSSELIETKSSRPV
PKPRGSVRKSGDSPPPDSRCCYCYTCTTHRPSFLPLHSASPAAQGDTAQQEADSQSQGST
TWLVDPKESKRTISTKYETTIF
Download sequence
Identical sequences H3C999
99883.ENSTNIP00000004821 ENSTNIP00000004821 ENSTNIP00000004821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]