SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004824 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004824
Domain Number 1 Region: 361-546
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.82e-43
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00043
Further Details:      
 
Domain Number 2 Region: 854-1008
Classification Level Classification E-value
Superfamily vWA-like 7.51e-16
Family Integrin A (or I) domain 0.056
Further Details:      
 
Domain Number 3 Region: 5-97
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000436
Family DNA topoisomerase II binding protein 1, TopBP1 0.054
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004824
Domain Number - Region: 1380-1390,1509-1547
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0654
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004824   Gene: ENSTNIG00000015654   Transcript: ENSTNIT00000004970
Sequence length 1662
Comment pep:known_by_projection chromosome:TETRAODON8:2:19792878:19801903:1 gene:ENSTNIG00000015654 transcript:ENSTNIT00000004970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSMGVFTNCSVLVELKTLPIKEKRSLKAAITENGGTICFVVNKQCSLILTSDASSLSPNR
LRSIRKHQTPVVGVEYVSSCLERGALLPLDGYRLDAPPTPAPPTKSSGGNPPLCPNLAKL
EPDFWDLLLCRVYGEDDSDLPPFPDRFQVAKYSIYEKSRSSSGWLLELQSLREEGGRRLL
IAKARLLEEAAVKEALVFPSTSEEALEVYECLRTSLLQSGLRQRRSLPAQARELGSAPLQ
QLLLEERLNTGTLTQEVGAFVELLWTEATGRLGDILTAPVEKLSLNDVSVAPRLQTDFLR
SPDPGSQVSMGVKEDAYRLIPVSTRCPRSLDVCQLIRDLLNVSEMTLRSSAPSCLGKYRA
LRCSLEAVPPNSSEFLDVAAQLQHSRVQIQQVLRVCRGVELQTFEADVGGIKPLLHSSRP
SNFVGLLSRGLLMPRVGVEHHGIERTDAGNLGSGIYFSDAFSTSLKYSHPGATDGSRLLL
VCDVALGRCQDVRKRDRTLSQAPDGYHSVHGVRSAPGAPSEFEDDEYVVYSPGQVRLKYV
VRFSMEGDQLKEFSPSVSTSAQPLPPPAVQELQSEEAEVVKNPVEDVKAGLLDSSGQQVP
LQAVHVRCKLMDLLSQVTIFQKYTNQRPEPIEAKFVFPLSDSAAVCGFEAFINGKHVVGQ
VKEKETARKEYKQAVERGHGAYLMDQDAPDVFTISVGNLPPAATVLVKVTFVSELVVQGG
SILFSLPGSVAPWQESAALNQTTQVTLEKVCVTEEEAASREFTLDACVEMPHEISRLTCL
THSVKTKRTDCKAVVSVLPGQILGPEGFQLSVSLSKAHLPRMWVEKHPEKDSQACMLVFY
PDFDIDAGSPPSNEVVLLLDTSESMRDSLHTLQEIALRVLKALHPDVKVNIILFGTDHSE
AFLTARPLGEAEGEVKSFVKRFTPVGGSTELWRPLRALSLLPPSRGLRNLLLLSDGHVQN
PELTLQLLRDGVQHSRLFPAASGLHGPTANRHMLRALAQAGGGAFEFFDTKSRHTWAEKV
ACQVKRMAAPGCSSVSVKWQQFNPTAPPPVQAPKQLHALFRDCHTLVYGFVPHCTQATLL
GSLSGKELRTMVSTSELQKTRGTFLHKLTARAVIRDYEDGNLDADAAQHEGKKAELREFV
ISLSKEFSILSQFTSFVAVEERGSAQDEGFTDVPKLIAEEDVDFLPYISWSSSQDMDMDR
HMDMLFMEEEYGSDSMDLGEPVLLESSRRDRRNVTEGMAEIQDSLCDFFSPPTSPPVEEP
CGIGAVQFSEPKPKSKAFSNLLFGHSFLAAQPFLRRFSPQSFSVPTCVGAAPAPHAVPFS
PFSFQILFGFCLCWCCSGSTCYQSLASAPPGFPLFAGLSPLSGSGVESLLDSPCVGAAPP
PQAAPPPPPPAHHLSGQYCISHYGAFGALPPADVLPRHFPARDSARVANTEVLIKRGKFE
GWFCGSLGTEEAAEVDWASRSSSSRSSSSRSSSSHSSSSRSSSSRSSTQSLAAPAAVPGG
FRRASPEGVNWNAIFRRQHVDGYWELTPELGKLLNFDVDLFVNVFLKSKGIDSLGARARA
DILRLLATLLVLQLMRVAKLEEGRLLRTLFSLVDPSQQRSRGGEQVKRAVDWVRWADRQY
PCICSRLEFGLSWESSTRQLLGFEDAHRSSPLTQIVLFYFEG
Download sequence
Identical sequences H3C9A2
99883.ENSTNIP00000004824 ENSTNIP00000004824 ENSTNIP00000004824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]