SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004825 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004825
Domain Number 1 Region: 280-552
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-73
Family Eukaryotic proteases 0.0000959
Further Details:      
 
Domain Number 2 Region: 164-272
Classification Level Classification E-value
Superfamily Kringle-like 1.62e-30
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 60-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000389
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004825
Domain Number - Region: 98-137
Classification Level Classification E-value
Superfamily FnI-like domain 0.00022
Family Fibronectin type I module 0.0037
Further Details:      
 
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily Kringle-like 0.0044
Family Fibronectin type II module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004825   Gene: ENSTNIG00000006059   Transcript: ENSTNIT00000004971
Sequence length 553
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:84843066:84847311:1 gene:ENSTNIG00000006059 transcript:ENSTNIT00000004971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFTTSGHECKFPFRQGGRIHHHCITFLSSRPCSSPDCAAALLLPDLQSAGFCFFVVQSPD
PCKVNPCQNGGVCALVPRTDGFRCSCGKSFTGALCELRRCYETSHLRYFDAGESWGRIHL
RNVEQCTCAAGQVSCEKVRYTACRSNPCHNDGTCRLISSTGREVCSCRHGYGGAHCGVDL
DSECYNSKGADYRGAAGTTLSGGQCLPWNSDLLYDELHVGTVEASSLRGLGGHAFCRNPD
GDAMPWCYTLSDGAISWEYCRLPSCAMAVSSSRRLNPFHAAAVAKMPAPNRRSKQPVCGR
RHQKRLAMARGRILGGNSALPGSHPWMAAIYVGQQDFCAGTLVSSCWVVSAAHCFFRSPL
LSQIRVVLGQQRFNVTDHNSKTFGVEKYVLPEQFSVFNPTLHDIVLIKLKKQDGRCARRT
PFISPICLPDKNTTFPDHFCCTISGWGHMHERGSTRVLAACEEAGVRLVPHHVCRRAEVY
GNHVTDGMLCAGLGGCADACQGDSGGPLACARDGVSFLYGVISWGEGCGRSGKPGVYTNV
LKYIDWIHSVLKR
Download sequence
Identical sequences H3C9A3
ENSTNIP00000004825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]