SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004884 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004884
Domain Number 1 Region: 215-377
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.35e-44
Family Pentapeptide repeats 0.00019
Further Details:      
 
Domain Number 2 Region: 88-189
Classification Level Classification E-value
Superfamily POZ domain 1.12e-27
Family Tetramerization domain of potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004884   Gene: ENSTNIG00000013598   Transcript: ENSTNIT00000005030
Sequence length 388
Comment pep:known_by_projection chromosome:TETRAODON8:4:3263699:3266365:1 gene:ENSTNIG00000013598 transcript:ENSTNIT00000005030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFVNGTTANGKVVAVYGSLDDLLSVASSKLGIRASSVYNGNGGLIDDISLIRDDD
VLFISEGESFEDPQEDLSGPERRQTHTDWLTLNVGGRCFTTTRSTLVSKEPESMLAHMFR
EKDVWGNKQDAQGAYLIDRSPDYFEPILNYLRHGQLIINEGINPLGVLEEARFFGIEQLA
EQLETLIKSSQPPDDHSPLTRKEFIRFLLATTTKSELRCQGLNFTGADLSRLDLRYINFK
MANLRGANLSGANLSGANLERADLSVACLDAANLQGVKMLCTNAEGASLRGCNFEDPAGI
KANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDLQ
EANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences H3C9G2
ENSTNIP00000004884 99883.ENSTNIP00000004884 ENSTNIP00000004884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]